General Information of Drug Off-Target (DOT) (ID: OTNZY74B)

DOT Name Growth/differentiation factor 7 (GDF7)
Synonyms GDF-7
Gene Name GDF7
Related Disease
Alzheimer disease ( )
Alzheimer disease 3 ( )
Atrial fibrillation ( )
Barrett esophagus ( )
Esophageal adenocarcinoma ( )
Familial multiple trichoepithelioma ( )
Prostate carcinoma ( )
Tendinopathy ( )
UniProt ID
GDF7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00019 ; PF00688
Sequence
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAA
AVPAAAVPRARAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADT
ITGFTDQATQDESAAETGQSFLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLL
LLSTCPGAARAPRLLYSRAAEPLVGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGP
VPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPL
PDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKE
LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARL
SPISILYIDAANNVVYKQYEDMVVEACGCR
Function May play an active role in the motor area of the primate neocortex.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
TGF-beta sig.ling pathway (hsa04350 )
Axon guidance (hsa04360 )
Hippo sig.ling pathway (hsa04390 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Biomarker [1]
Alzheimer disease 3 DISVT69G Strong Biomarker [1]
Atrial fibrillation DIS15W6U Strong Altered Expression [2]
Barrett esophagus DIS416Y7 Strong Genetic Variation [3]
Esophageal adenocarcinoma DISODWFP Strong Genetic Variation [3]
Familial multiple trichoepithelioma DISKZAUY Strong Genetic Variation [3]
Prostate carcinoma DISMJPLE Strong Genetic Variation [4]
Tendinopathy DISJH7UX Strong Biomarker [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Growth/differentiation factor 7 (GDF7). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Growth/differentiation factor 7 (GDF7). [10]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Growth/differentiation factor 7 (GDF7). [7]
Triclosan DMZUR4N Approved Triclosan increases the expression of Growth/differentiation factor 7 (GDF7). [8]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Growth/differentiation factor 7 (GDF7). [9]
------------------------------------------------------------------------------------

References

1 Synergistic promoting effects of bone morphogenetic protein 12/connective tissue growth factor on functional differentiation of tendon derived stem cells and patellar tendon window defect regeneration.J Biomech. 2018 Jan 3;66:95-102. doi: 10.1016/j.jbiomech.2017.11.004. Epub 2017 Nov 7.
2 Genome-wide profiling reveals atrial fibrillation-related circular RNAs in atrial appendages.Gene. 2020 Feb 20;728:144286. doi: 10.1016/j.gene.2019.144286. Epub 2019 Dec 12.
3 The Barrett-associated variants at GDF7 and TBX5 also increase esophageal adenocarcinoma risk.Cancer Med. 2016 May;5(5):888-91. doi: 10.1002/cam4.641. Epub 2016 Jan 18.
4 Association analyses of more than 140,000 men identify 63 new prostate cancer susceptibility loci.Nat Genet. 2018 Jul;50(7):928-936. doi: 10.1038/s41588-018-0142-8. Epub 2018 Jun 11.
5 Aspirin promotes tenogenic differentiation of tendon stem cells and facilitates tendinopathy healing through regulating the GDF7/Smad1/5 signaling pathway.J Cell Physiol. 2020 May;235(5):4778-4789. doi: 10.1002/jcp.29355. Epub 2019 Oct 21.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
8 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
9 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.