Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOE4G8T)

• DOT Name: Transmembrane protein 187 (TMEM187)
• Synonyms: Protein ITBA1
• Gene Name: TMEM187
• Related Disease:
  Autism spectrum disorder
  Coeliac disease
  Pervasive developmental disorder
  Systemic lupus erythematosus
  Rheumatoid arthritis
• UniProt ID: TM187_HUMAN
• Pfam ID: PF15100
• Sequence:
  MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLV
  NMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTL
  PIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALR
  THRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFA
  FLFLTHFNTHPRFHPSGGKTR
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[1]
Coeliac disease	DISIY60C	Strong	Genetic Variation	[2]
Pervasive developmental disorder	DIS51975	Strong	Genetic Variation	[1]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[3]
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[4]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transmembrane protein 187 (TMEM187).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Transmembrane protein 187 (TMEM187).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Transmembrane protein 187 (TMEM187).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transmembrane protein 187 (TMEM187).	[8]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Transmembrane protein 187 (TMEM187).	[9]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Transmembrane protein 187 (TMEM187).	[10]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Transmembrane protein 187 (TMEM187).	[11]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Transmembrane protein 187 (TMEM187).	[12]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transmembrane protein 187 (TMEM187).	[13]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Transmembrane protein 187 (TMEM187).	[14]

References

• [1] High Functioning Autism with Missense Mutations in Synaptotagmin-Like Protein 4 (SYTL4) and Transmembrane Protein 187 (TMEM187) Genes: SYTL4- Protein Modeling, Protein-Protein Interaction, Expression Profiling and MicroRNA Studies.Int J Mol Sci. 2019 Jul 9;20(13):3358. doi: 10.3390/ijms20133358.
• [2] High-density genetic mapping identifies new susceptibility loci for rheumatoid arthritis.Nat Genet. 2012 Dec;44(12):1336-40. doi: 10.1038/ng.2462. Epub 2012 Nov 11.
• [3] Fine mapping of Xq28: both MECP2 and IRAK1 contribute to risk for systemic lupus erythematosus in multiple ancestral groups.Ann Rheum Dis. 2013 Mar;72(3):437-44. doi: 10.1136/annrheumdis-2012-201851. Epub 2012 Aug 17.
• [4] TMEM187-IRAK1 Polymorphisms Associated with Rheumatoid Arthritis Susceptibility in Tunisian and French Female Populations: Influence of Geographic Origin.J Immunol Res. 2017;2017:4915950. doi: 10.1155/2017/4915950. Epub 2017 Feb 8.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [10] New insights into the mechanisms underlying 5-fluorouracil-induced intestinal toxicity based on transcriptomic and metabolomic responses in human intestinal organoids. Arch Toxicol. 2021 Aug;95(8):2691-2718. doi: 10.1007/s00204-021-03092-2. Epub 2021 Jun 20.
• [11] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [14] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.