Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOXOA0Q)

• DOT Name: Alanine aminotransferase 1 (GPT)
• Synonyms: ALT1; EC 2.6.1.2; Glutamate pyruvate transaminase 1; GPT 1; Glutamic--alanine transaminase 1; Glutamic--pyruvic transaminase 1
• Gene Name: GPT
• UniProt ID: ALAT1_HUMAN
• EC Number: 2.6.1.2
• Pfam ID: PF00155
• Sequence:
  MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
  TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
  GAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT
  GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVI
  NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
  AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
  VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
  PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
  LEKLSRFHAKFTLEYS
• Function: Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
• Tissue Specificity: Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue.
• KEGG Pathway:
  Arginine biosynthesis (hsa00220)
  Alanine, aspartate and glutamate metabolism (hsa00250)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  2-Oxocarboxylic acid metabolism (hsa01210)
  Biosynthesis of amino acids (hsa01230)
• Reactome Pathway: Alanine metabolism (R-HSA-8964540)
• BioCyc Pathway: MetaCyc:HS09610-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 9 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cocaine	DMSOX7I	Approved	Alanine aminotransferase 1 (GPT) increases the Liver injury ADR of Cocaine.	[22]
Phenytoin	DMNOKBV	Approved	Alanine aminotransferase 1 (GPT) increases the Jaundice ADR of Phenytoin.	[22]
Lovastatin	DM9OZWQ	Approved	Alanine aminotransferase 1 (GPT) increases the Hepatotoxicity ADR of Lovastatin.	[22]
Ciprofloxacin XR	DM2NLS9	Approved	Alanine aminotransferase 1 (GPT) increases the Haematotoxicity ADR of Ciprofloxacin XR.	[22]
Erythromycin	DM4K7GQ	Approved	Alanine aminotransferase 1 (GPT) increases the Gastrointestinal disorders ADR of Erythromycin.	[22]
Furazolidone	DM3P6V7	Approved	Alanine aminotransferase 1 (GPT) increases the Decreased appetite ADR of Furazolidone.	[22]
Primidone	DM0WX6I	Approved	Alanine aminotransferase 1 (GPT) increases the Jaundice ADR of Primidone.	[22]
Halothane	DM80OZ5	Approved	Alanine aminotransferase 1 (GPT) increases the Adverse drug reaction ADR of Halothane.	[22]
Theophylline	DMRJFN9	Approved	Alanine aminotransferase 1 (GPT) increases the Metabolic acidosis ADR of Theophylline.	[22]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Alanine aminotransferase 1 (GPT).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Alanine aminotransferase 1 (GPT).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Alanine aminotransferase 1 (GPT).	[19]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Alanine aminotransferase 1 (GPT).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the activity of Alanine aminotransferase 1 (GPT).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Alanine aminotransferase 1 (GPT).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the activity of Alanine aminotransferase 1 (GPT).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Alanine aminotransferase 1 (GPT).	[7]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Alanine aminotransferase 1 (GPT).	[8]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Alanine aminotransferase 1 (GPT).	[9]
Ethanol	DMDRQZU	Approved	Ethanol increases the activity of Alanine aminotransferase 1 (GPT).	[10]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Alanine aminotransferase 1 (GPT).	[12]
Isoniazid	DM5JVS3	Approved	Isoniazid increases the expression of Alanine aminotransferase 1 (GPT).	[14]
SR141716A	DMCO5JZ	Approved	SR141716A decreases the expression of Alanine aminotransferase 1 (GPT).	[15]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Alanine aminotransferase 1 (GPT).	[16]
Triptolide	DMCMDVR	Phase 3	Triptolide increases the expression of Alanine aminotransferase 1 (GPT).	[17]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the activity of Alanine aminotransferase 1 (GPT).	[18]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Alanine aminotransferase 1 (GPT).	[2]

21 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Diclofenac	DMPIHLS	Approved	Diclofenac increases the secretion of Alanine aminotransferase 1 (GPT).	[11]
Palbociclib	DMD7L94	Approved	Palbociclib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Sorafenib	DMS8IFC	Approved	Sorafenib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Gefitinib	DM15F0X	Approved	Gefitinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Imatinib	DM7RJXL	Approved	Imatinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Crizotinib	DM4F29C	Approved	Crizotinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Nilotinib	DM7HXWT	Approved	Nilotinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Lapatinib	DM3BH1Y	Approved	Lapatinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Vandetanib	DMRICNP	Approved	Vandetanib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Ibrutinib	DMHZCPO	Approved	Ibrutinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Osimertinib	DMRJLAT	Approved	Osimertinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Regorafenib	DMHSY1I	Approved	Regorafenib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Ceritinib	DMB920Z	Approved	Ceritinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Bosutinib	DMTI8YE	Approved	Bosutinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Cabozantinib	DMIYDT4	Approved	Cabozantinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
Alectinib	DMP1I6Y	Approved	Alectinib increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
LEE011	DMMX75K	Phase 3	LEE011 increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
PMID25656651-Compound-5	DMAI95U	Patented	PMID25656651-Compound-5 increases the secretion of Alanine aminotransferase 1 (GPT).	[13]
D-glucose	DMMG2TO	Investigative	D-glucose increases the secretion of Alanine aminotransferase 1 (GPT).	[20]
Icariside II	DM3DB8X	Investigative	Icariside II increases the secretion of Alanine aminotransferase 1 (GPT).	[21]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Drug-induced liver injury: Oltipraz and C2-ceramide intervene HNF-1/GSTA1 expression via JNK signaling pathway. J Appl Toxicol. 2021 Dec;41(12):2011-2020. doi: 10.1002/jat.4181. Epub 2021 May 6.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Different administration patterns of docosahexaenoic acid in combating cytotoxic manifestations due to arsenic trioxide (acute promyelocytic leukemia drug) induced redox imbalance in hepatocytes. Prostaglandins Other Lipid Mediat. 2018 May;136:64-75.
• [7] A Study of Gentianae Radix et Rhizoma Class Differences Based on Chemical Composition and Core Efficacy. Molecules. 2023 Oct 17;28(20):7132. doi: 10.3390/molecules28207132.
• [8] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [9] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [10] Dihydroartemisinin protects against alcoholic liver injury through alleviating hepatocyte steatosis in a farnesoid X receptor-dependent manner. Toxicol Appl Pharmacol. 2017 Jan 15;315:23-34. doi: 10.1016/j.taap.2016.12.001. Epub 2016 Dec 6.
• [11] Human HepaRG liver spheroids: cold storage protocol and study on pyridinium oxime-induced hepatotoxicity in vitro. Chem Biol Interact. 2023 Jan 5;369:110285. doi: 10.1016/j.cbi.2022.110285. Epub 2022 Nov 26.
• [12] Rifampicin-induced injury in L02 cells is alleviated by 4-PBA via inhibition of the PERK-ATF4-CHOP pathway. Toxicol In Vitro. 2016 Oct;36:186-196. doi: 10.1016/j.tiv.2016.07.017. Epub 2016 Jul 26.
• [13] Cytotoxicity of 34 FDA approved small-molecule kinase inhibitors in primary rat and human hepatocytes. Toxicol Lett. 2018 Jul;291:138-148. doi: 10.1016/j.toxlet.2018.04.010. Epub 2018 Apr 12.
• [14] Quercetin protected against isoniazide-induced HepG2 cell apoptosis by activating the SIRT1/ERK pathway. J Biochem Mol Toxicol. 2019 Sep;33(9):e22369. doi: 10.1002/jbt.22369. Epub 2019 Jul 23.
• [15] Endocannabinoid receptor blockade reduces alanine aminotransferase in polycystic ovary syndrome independent of weight loss. BMC Endocr Disord. 2017 Jul 14;17(1):41. doi: 10.1186/s12902-017-0194-2.
• [16] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [17] Catalpol and panax notoginseng saponins synergistically alleviate triptolide-induced hepatotoxicity through Nrf2/ARE pathway. Toxicol In Vitro. 2019 Apr;56:141-149. doi: 10.1016/j.tiv.2019.01.016. Epub 2019 Jan 23.
• [18] How useful are clinical liver function tests in in vitro human hepatotoxicity assays?. Toxicol In Vitro. 2014 Aug;28(5):784-95. doi: 10.1016/j.tiv.2014.03.006. Epub 2014 Mar 28.
• [19] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [20] Protective effect of solanesol in glucose-induced hepatocyte injury: Mechanistic insights on oxidative stress and mitochondrial preservation. Chem Biol Interact. 2023 Sep 25;383:110676. doi: 10.1016/j.cbi.2023.110676. Epub 2023 Aug 14.
• [21] Baohuoside I inhibits FXR signaling pathway to interfere with bile acid homeostasis via targeting ER degradation. Cell Biol Toxicol. 2023 Aug;39(4):1215-1235. doi: 10.1007/s10565-022-09737-x. Epub 2022 Jul 8.
• [22] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.