Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOYH74A)

• DOT Name: Immortalization up-regulated protein (C19ORF33)
• Synonyms: Hepatocyte growth factor activator inhibitor type 2-related small protein; H2RSP; HAI-2-related small protein
• Gene Name: C19ORF33
• Related Disease:
  Colitis
  Eclampsia
  Epithelial neoplasm
  Endometrial carcinoma
  Endometrium neoplasm
  Neoplasm
• UniProt ID: IMUP_HUMAN
• Pfam ID: PF15761
• Sequence:
  MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSSSDSSSSSS
  DSDTDVKSHAAGSKQHESIPGKAKKPKVKKKEKGKKEKGKKKEAPH

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colitis	DISAF7DD	Strong	Genetic Variation	[1]
Eclampsia	DISWPO8U	Strong	Biomarker	[2]
Epithelial neoplasm	DIS0T594	Strong	Biomarker	[3]
Endometrial carcinoma	DISXR5CY	Disputed	Altered Expression	[4]
Endometrium neoplasm	DIS6OS2L	Disputed	Altered Expression	[4]
Neoplasm	DISZKGEW	Disputed	Altered Expression	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Immortalization up-regulated protein (C19ORF33).	[5]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Immortalization up-regulated protein (C19ORF33).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Immortalization up-regulated protein (C19ORF33).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Immortalization up-regulated protein (C19ORF33).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Immortalization up-regulated protein (C19ORF33).	[9]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Immortalization up-regulated protein (C19ORF33).	[10]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Immortalization up-regulated protein (C19ORF33).	[11]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Immortalization up-regulated protein (C19ORF33).	[11]
Coprexa	DMA0WEK	Phase 3	Coprexa decreases the expression of Immortalization up-regulated protein (C19ORF33).	[12]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Immortalization up-regulated protein (C19ORF33).	[13]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Immortalization up-regulated protein (C19ORF33).	[14]

References

• [1] Nuclear translocation of H2RSP is impaired in regenerating intestinal epithelial cells of murine colitis model.Virchows Arch. 2006 Mar;448(3):354-60. doi: 10.1007/s00428-005-0064-6. Epub 2005 Sep 28.
• [2] Hypoxia-induced downregulation of XIAP in trophoblasts mediates apoptosis via interaction with IMUP-2: implications for placental development during pre-eclampsia.J Cell Biochem. 2013 Jan;114(1):89-98. doi: 10.1002/jcb.24304.
• [3] IMUP-1 and IMUP-2 genes are up-regulated in human ovarian epithelial tumors.Anticancer Res. 2003 Nov-Dec;23(6C):4709-13.
• [4] Imup-1 and imup-2 overexpression in endometrial carcinoma in Korean and Japanese populations.Anticancer Res. 2008 Mar-Apr;28(2A):865-71.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [10] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [11] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [12] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [13] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [14] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.