Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOZYJMO)

DOT Name BPI fold-containing family B member 1 (BPIFB1)
Synonyms Long palate, lung and nasal epithelium carcinoma-associated protein 1; von Ebner minor salivary gland protein; VEMSGP
Gene Name BPIFB1
Related Disease
Bacterial pneumonia ( )
Cystic fibrosis ( )
Lung adenocarcinoma ( )
Nasopharyngeal carcinoma ( )
Pneumonitis ( )
Pulmonary disease ( )
Vibrio cholerae infection ( )
Chronic obstructive pulmonary disease ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Autoimmune disease ( )
Autoimmune polyendocrine syndrome type 1 ( )
Connective tissue disorder ( )
Neoplasm ( )
UniProt ID
BPIB1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01273 ; PF02886
Sequence
MAGPWTFTLLCGLLAATLIQATLSPTAVLILGPKVIKEKLTQELKDHNATSILQQLPLLS
AMREKPAGGIPVLGSLVNTVLKHIIWLKVITANILQLQVKPSANDQELLVKIPLDMVAGF
NTPLVKTIVEFHMTTEAQATIRMDTSASGPTRLVLSDCATSHGSLRIQLLHKLSFLVNAL
AKQVMNLLVPSLPNLVKNQLCPVIEASFNGMYADLLQLVKVPISLSIDRLEFDLLYPAIK
GDTIQLYLGAKLLDSQGKVTKWFNNSAASLTMPTLDNIPFSLIVSQDVVKAAVAAVLSPE
EFMVLLDSVLPESAHRLKSSIGLINEKAADKLGSTQIVKILTQDTPEFFIDQGHAKVAQL
IVLEVFPSSEALRPLFTLGIEASSEAQFYTKGDQLILNLNNISSDRIQLMNSGIGWFQPD
VLKNIITEIIHSILLPNQNGKLRSGVPVSLVKALGFEAAESSLTKDALVLTPASLWKPSS
PVSQ
Function May play a role in innate immunity in mouth, nose and lungs. Binds bacterial lipopolysaccharide (LPS) and modulates the cellular responses to LPS.
Tissue Specificity Detected in duodenum mucosal crypts of cholera patients, near Paneth cells (at protein level). Detected in trachea, nasal septal epithelium and lung.
Reactome Pathway
Antimicrobial peptides (R-HSA-6803157 )

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bacterial pneumonia DISPW7PH Strong Biomarker [1]
Cystic fibrosis DIS2OK1Q Strong Genetic Variation [2]
Lung adenocarcinoma DISD51WR Strong Genetic Variation [3]
Nasopharyngeal carcinoma DISAOTQ0 Strong Biomarker [4]
Pneumonitis DIS88E0K Strong Genetic Variation [5]
Pulmonary disease DIS6060I Strong Genetic Variation [2]
Vibrio cholerae infection DISW7E3U Strong Genetic Variation [6]
Chronic obstructive pulmonary disease DISQCIRF moderate Altered Expression [7]
Lung cancer DISCM4YA moderate Genetic Variation [8]
Lung carcinoma DISTR26C moderate Genetic Variation [8]
Lung neoplasm DISVARNB moderate Altered Expression [8]
Autoimmune disease DISORMTM Limited Biomarker [9]
Autoimmune polyendocrine syndrome type 1 DISWJP8J Limited Biomarker [9]
Connective tissue disorder DISKXBS3 Limited Biomarker [9]
Neoplasm DISZKGEW Limited Biomarker [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of BPI fold-containing family B member 1 (BPIFB1). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of BPI fold-containing family B member 1 (BPIFB1). [11]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of BPI fold-containing family B member 1 (BPIFB1). [12]
------------------------------------------------------------------------------------

References

1 BPIFB1 (LPLUNC1) is upregulated in cystic fibrosis lung disease.Histochem Cell Biol. 2012 Nov;138(5):749-58. doi: 10.1007/s00418-012-0990-8. Epub 2012 Jul 6.
2 Polymorphisms associated with expression of BPIFA1/BPIFB1 and lung disease severity in cystic fibrosis.Am J Respir Cell Mol Biol. 2015 Nov;53(5):607-14. doi: 10.1165/rcmb.2014-0182OC.
3 Characteristics of genomic alterations of lung adenocarcinoma in young never-smokers.Int J Cancer. 2018 Oct 1;143(7):1696-1705. doi: 10.1002/ijc.31542. Epub 2018 May 7.
4 LPLUNC1 stabilises PHB1 by counteracting TRIM21-mediated ubiquitination to inhibit NF-B activity in nasopharyngeal carcinoma.Oncogene. 2019 Jun;38(25):5062-5075. doi: 10.1038/s41388-019-0778-6. Epub 2019 Mar 18.
5 Lymphocyte-driven regional immunopathology in pneumonitis caused by impaired central immune tolerance.Sci Transl Med. 2019 Jun 5;11(495):eaav5597. doi: 10.1126/scitranslmed.aav5597.
6 Genetics of susceptibility to infection with enteric pathogens.Curr Opin Infect Dis. 2009 Oct;22(5):471-6. doi: 10.1097/QCO.0b013e3283304eb6.
7 Association of innate defense proteins BPIFA1 and BPIFB1 with disease severity in COPD.Int J Chron Obstruct Pulmon Dis. 2017 Dec 19;13:11-27. doi: 10.2147/COPD.S144136. eCollection 2018.
8 Low-frequency coding variants at 6p21.33 and 20q11.21 are associated with lung cancer risk in Chinese populations.Am J Hum Genet. 2015 May 7;96(5):832-40. doi: 10.1016/j.ajhg.2015.03.009. Epub 2015 Apr 30.
9 BPIFB1 is a lung-specific autoantigen associated with interstitial lung disease.Sci Transl Med. 2013 Oct 9;5(206):206ra139. doi: 10.1126/scitranslmed.3006998.
10 Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
11 Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
12 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.