Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP4468N)

• DOT Name: Protein SDA1 homolog (SDAD1)
• Synonyms: Nucleolar protein 130; SDA1 domain-containing protein 1; hSDA
• Gene Name: SDAD1
• Related Disease:
  Allergic rhinitis
  Colon cancer
  Colon carcinoma
  Seasonal allergic rhinitis
  Gastric cancer
  Stomach cancer
• UniProt ID: SDA1_HUMAN
• PDB ID: 8FL2; 8FL3; 8FL4; 8IDY; 8INF; 8INK; 8IPY
• Pfam ID: PF21638 ; PF05285 ; PF08158
• Sequence:
  MSNRNNNKLPSNLPQLQNLIKRDPPAYIEEFLQQYNHYKSNVEIFKLQPNKPSKELAELV
  MFMAQISHCYPEYLSNFPQEVKDLLSCNHTVLDPDLRMTFCKALILLRNKNLINPSSLLE
  LFFELFRCHDKLLRKTLYTHIVTDIKNINAKHKNNKVNVVLQNFMYTMLRDSNATAAKMS
  LDVMIELYRRNIWNDAKTVNVITTACFSKVTKILVAALTFFLGKDEDEKQDSDSESEDDG
  PTARDLLVQYATGKKSSKNKKKLEKAMKVLKKQKKKKKPEVFNFSAIHLIHDPQDFAEKL
  LKQLECCKERFEVKMMLMNLISRLVGIHELFLFNFYPFLQRFLQPHQREVTKILLFAAQA
  SHHLVPPEIIQSLLMTVANNFVTDKNSGEVMTVGINAIKEITARCPLAMTEELLQDLAQY
  KTHKDKNVMMSARTLIHLFRTLNPQMLQKKFRGKPTEASIEARVQEYGELDAKDYIPGAE
  VLEVEKEENAENDEDGWESTSLSEEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKA
  KAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIE
  RLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKKQKNFMMMRYSQNV
  RSKNKRSFREKQLALRDALLKKRKRMK
• Function: Required for 60S pre-ribosomal subunits export to the cytoplasm.
• Tissue Specificity: Highly expressed in testis, kidney, spleen, brain and fetal tissues. Also expressed at lower level in heart, lung, liver, small intestine, ovary, uterus, mammary gland and placenta.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Allergic rhinitis	DIS3U9HN	Strong	Genetic Variation	[1]
Colon cancer	DISVC52G	Strong	Biomarker	[2]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[2]
Seasonal allergic rhinitis	DIS58KQX	Strong	Biomarker	[1]
Gastric cancer	DISXGOUK	Limited	Biomarker	[3]
Stomach cancer	DISKIJSX	Limited	Biomarker	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein SDA1 homolog (SDAD1).	[4]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein SDA1 homolog (SDAD1).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein SDA1 homolog (SDAD1).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein SDA1 homolog (SDAD1).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein SDA1 homolog (SDAD1).	[8]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Protein SDA1 homolog (SDAD1).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein SDA1 homolog (SDAD1).	[10]

References

• [1] Association of a haplotype block spanning SDAD1 gene and CXC chemokine genes with allergic rhinitis.J Allergy Clin Immunol. 2005 Mar;115(3):548-54. doi: 10.1016/j.jaci.2004.11.034.
• [2] miR-378 suppresses the proliferation, migration and invasion of colon cancer cells by inhibiting SDAD1.Cell Mol Biol Lett. 2017 Jul 17;22:12. doi: 10.1186/s11658-017-0041-5. eCollection 2017.
• [3] LncRNA TP73-AS1 accelerates tumor progression in gastric cancer through regulating miR-194-5p/SDAD1 axis.Pathol Res Pract. 2018 Dec;214(12):1993-1999. doi: 10.1016/j.prp.2018.09.006. Epub 2018 Sep 13.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [6] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [7] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [8] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [9] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.