Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPR3C6A)

DOT Name TBC1 domain family member 16 (TBC1D16)
Gene Name TBC1D16
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Neoplasm ( )
Epithelial ovarian cancer ( )
Melanoma ( )
UniProt ID
TBC16_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00566
Sequence
MSLGRLLRRASSKASDLLTLTPGGSGSGSPSVLDGEIIYSKNNVCVHPPEGLQGLGEHHP
GYLCLYMEKDEMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG
ASHQPSPTELRPTLTPKDEDILVVAQSVPDRMLASPAPEDEEKLAQGLGVDGAQPASQPA
CSPSGILSTVSPQDVTEEGREPRPEAGEEDGSLELSAEGVSRDSSFDSDSDTFSSPFCLS
PISAALAESRGSVFLESDSSPPSSSDAGLRFPDSNGLLQTPRWDEPQRVCALEQICGVFR
VDLGHMRSLRLFFSDEACTSGQLVVASRESQYKVFHFHHGGLDKLSDVFQQWKYCTEMQL
KDQQVAPDKTCMQFSIRRPKLPSSETHPEESMYKRLGVSAWLNHLNELGQVEEEYKLRKA
IFFGGIDVSIRGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAF
WRNVQFTVDKDVVRTDRNNQFFRGEDNPNVESMRRILLNYAVYNPAVGYSQGMSDLVAPI
LAEVLDESDTFWCFVGLMQNTIFVSSPRDEDMEKQLLYLRELLRLTHVRFYQHLVSLGED
GLQMLFCHRWLLLCFKREFPEAEALRIWEACWAHYQTDYFHLFICVAIVAIYGDDVIEQQ
LATDQMLLHFGNLAMHMNGELVLRKARSLLYQFRLLPRIPCSLHDLCKLCGSGMWDSGSM
PAVECTGHHPGSESCPYGGTVEMPSPKSLREGKKGPKTPQDGFGFRR
Function May act as a GTPase-activating protein for Rab family protein(s).
Reactome Pathway
TBC/RABGAPs (R-HSA-8854214 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Definitive Biomarker [1]
Breast carcinoma DIS2UE88 Definitive Biomarker [1]
Neoplasm DISZKGEW Definitive Posttranslational Modification [1]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [2]
Melanoma DIS1RRCY Limited Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of TBC1 domain family member 16 (TBC1D16). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of TBC1 domain family member 16 (TBC1D16). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of TBC1 domain family member 16 (TBC1D16). [5]
Estradiol DMUNTE3 Approved Estradiol increases the expression of TBC1 domain family member 16 (TBC1D16). [6]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of TBC1 domain family member 16 (TBC1D16). [8]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of TBC1 domain family member 16 (TBC1D16). [9]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of TBC1 domain family member 16 (TBC1D16). [10]
Panobinostat DM58WKG Approved Panobinostat increases the expression of TBC1 domain family member 16 (TBC1D16). [8]
Camptothecin DM6CHNJ Phase 3 Camptothecin decreases the expression of TBC1 domain family member 16 (TBC1D16). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of TBC1 domain family member 16 (TBC1D16). [11]
Scriptaid DM9JZ21 Preclinical Scriptaid increases the expression of TBC1 domain family member 16 (TBC1D16). [8]
Oxamflatin DM1TG3C Terminated Oxamflatin increases the expression of TBC1 domain family member 16 (TBC1D16). [8]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of TBC1 domain family member 16 (TBC1D16). [14]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of TBC1 domain family member 16 (TBC1D16). [15]
Butanoic acid DMTAJP7 Investigative Butanoic acid increases the expression of TBC1 domain family member 16 (TBC1D16). [8]
Apicidin DM83WVF Investigative Apicidin increases the expression of TBC1 domain family member 16 (TBC1D16). [8]
Octanedioic acid bis-hydroxyamide DMJNQ9K Investigative Octanedioic acid bis-hydroxyamide increases the expression of TBC1 domain family member 16 (TBC1D16). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of TBC1 domain family member 16 (TBC1D16). [7]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of TBC1 domain family member 16 (TBC1D16). [12]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of TBC1 domain family member 16 (TBC1D16). [13]
------------------------------------------------------------------------------------

References

1 Characterisation of DNA methylation changes in EBF3 and TBC1D16 associated with tumour progression and metastasis in multiple cancer types.Clin Epigenetics. 2019 Aug 5;11(1):114. doi: 10.1186/s13148-019-0710-5.
2 Expression of TBC1D16 Is Associated with Favorable Prognosis of Epithelial Ovarian Cancer.Tohoku J Exp Med. 2018 Jul;245(3):141-148. doi: 10.1620/tjem.245.141.
3 Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
7 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
8 Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
9 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
10 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
11 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
14 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
15 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.