Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRAOBYH)

DOT Name Adhesion G-protein coupled receptor F1 (ADGRF1)
Synonyms G protein-coupled receptor 110; G protein-coupled receptor KPG_012; G protein-coupled receptor PGR19
Gene Name ADGRF1
Related Disease
Advanced cancer ( )
Bone osteosarcoma ( )
Gonorrhea ( )
Hepatocellular carcinoma ( )
Her2-receptor negative breast cancer ( )
HER2/NEU overexpressing breast cancer ( )
Liver cirrhosis ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Osteosarcoma ( )
Glioma ( )
UniProt ID
AGRF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7WU3; 7WU4; 7WU5; 7WXU; 7WXW; 7WY0; 7WZ7; 7X2V
Pfam ID
PF00002 ; PF01825 ; PF01390
Sequence
MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSK
EKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQ
NCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANG
IEIQLKKAYERIQGFESVQVTQFRNGSIVAGYEVVGSSSASELLSAIEHVAEKAKTALHK
LFPLEDGSFRVFGKAQCNDIVFGFGSKDDEYTLPCSSGYRGNITAKCESSGWQVIRETCV
LSLLEELNKNFSMIVGNATEAAVSSFVQNLSVIIRQNPSTTVGNLASVVSILSNISSLSL
ASHFRVSNSTMEDVISIADNILNSASVTNWTVLLREEKYASSRLLETLENISTLVPPTAL
PLNFSRKFIDWKGIPVNKSQLKRGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPETII
SMASLTLGNILPVSKNGNAQVNGPVISTVIQNYSINEVFLFFSKIESNLSQPHCVFWDFS
HLQWNDAGCHLVNETQDIVTCQCTHLTSFSILMSPFVPSTIFPVVKWITYVGLGISIGSL
ILCLIIEALFWKQIKKSQTSHTRRICMVNIALSLLIADVWFIVGATVDTTVNPSGVCTAA
VFFTHFFYLSLFFWMLMLGILLAYRIILVFHHMAQHLMMAVGFCLGYGCPLIISVITIAV
TQPSNTYKRKDVCWLNWSNGSKPLLAFVVPALAIVAVNFVVVLLVLTKLWRPTVGERLSR
DDKATIIRVGKSLLILTPLLGLTWGFGIGTIVDSQNLAWHVIFALLNAFQGFFILCFGIL
LDSKLRQLLFNKLSALSSWKQTEKQNSSDLSAKPKFSKPFNPLQNKGHYAFSHTGDSSDN
IMLTQFVSNE
Function Orphan receptor.
Tissue Specificity Mainly expressed in the kidney. Up-regulated in lung adenocarcinomas and prostate cancers.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Bone osteosarcoma DIST1004 Strong Altered Expression [1]
Gonorrhea DISQ5AO6 Strong Biomarker [2]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [2]
Her2-receptor negative breast cancer DISS605N Strong Altered Expression [3]
HER2/NEU overexpressing breast cancer DISYKID5 Strong Altered Expression [3]
Liver cirrhosis DIS4G1GX Strong Biomarker [4]
Neoplasm DISZKGEW Strong Altered Expression [3]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [5]
Osteosarcoma DISLQ7E2 Strong Altered Expression [1]
Glioma DIS5RPEH moderate Biomarker [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Adhesion G-protein coupled receptor F1 (ADGRF1). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Adhesion G-protein coupled receptor F1 (ADGRF1). [12]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Adhesion G-protein coupled receptor F1 (ADGRF1). [7]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Adhesion G-protein coupled receptor F1 (ADGRF1). [8]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Adhesion G-protein coupled receptor F1 (ADGRF1). [9]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Adhesion G-protein coupled receptor F1 (ADGRF1). [10]
Rofecoxib DM3P5DA Approved Rofecoxib affects the expression of Adhesion G-protein coupled receptor F1 (ADGRF1). [11]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Adhesion G-protein coupled receptor F1 (ADGRF1). [13]
QUERCITRIN DM1DH96 Investigative QUERCITRIN decreases the expression of Adhesion G-protein coupled receptor F1 (ADGRF1). [14]
CH-223191 DMMJZYC Investigative CH-223191 decreases the expression of Adhesion G-protein coupled receptor F1 (ADGRF1). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Clinical Significance of G Protein-Coupled Receptor 110 (GPR110) as a Novel Prognostic Biomarker in Osteosarcoma.Med Sci Monit. 2018 Jul 27;24:5216-5224. doi: 10.12659/MSM.909555.
2 Clinicopathological and prognostic significance of aberrant G protein-couple receptor 110 (GPR110) expression in gastric cancer.Pathol Res Pract. 2019 Mar;215(3):539-545. doi: 10.1016/j.prp.2018.12.004. Epub 2018 Dec 6.
3 GPCRs profiling and identification of GPR110 as a potential new target in HER2+ breast cancer.Breast Cancer Res Treat. 2018 Jul;170(2):279-292. doi: 10.1007/s10549-018-4751-9. Epub 2018 Mar 24.
4 Gpr110 deficiency decelerates carcinogen-induced hepatocarcinogenesis via activation of the IL-6/STAT3 pathway.Am J Cancer Res. 2017 Mar 1;7(3):433-447. eCollection 2017.
5 Polymorphisms in genes related to epithelial-mesenchymal transition and risk of non-small cell lung cancer.Carcinogenesis. 2017 Oct 1;38(10):1029-1035. doi: 10.1093/carcin/bgx079.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
8 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
9 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
10 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
11 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
14 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
15 The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.