Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSBSCLF)

• DOT Name: Transcription elongation regulator 1-like protein (TCERG1L)
• Gene Name: TCERG1L
• Related Disease:
  Advanced cancer
  Carcinoma
  Neoplasm
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Cowden disease
  Obesity
  Type-1/2 diabetes
  Ulcerative colitis
  Colorectal neoplasm
  Lung carcinoma
• UniProt ID: TCRGL_HUMAN
• Pfam ID: PF01846
• Sequence:
  MQAGARFQRRRRQLQQQQPRRRQPLLWPMDAEPPPPPPWVWMVPGSAGLLRLSAGVVVPP
  VLLASAPPPAAPLLPGLPGWPAPSEPVLPLLPLPSAPDSAAAAAAHPFPALHGQWLFGGH
  SPSLGLPPSSTVELVPVFPHLCPSALATPIGKSWIDKRIPNCKIFFNNSFALDSTWIHPE
  ESRFFHGHEKPRLLANQVAVSLSRPAPASRPLPTVVLAPQPIPGGCHNSLKVTSSPAIAI
  ATAAAAAMVSVDPENLRGPSPSSVQPRHFLTLAPIKIPLRTSPVSDTRTERGRVARPPAL
  MLRAQKSRDGDKEDKEPPPMLGGGEDSTARGNRPVASTPVPGSPWCVVWTGDDRVFFFNP
  TMHLSVWEKPMDLKDRGDLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNR
  TEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIV
  FDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKE
  FAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDKENRLRLRKMR

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Posttranslational Modification	[1]
Carcinoma	DISH9F1N	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Colon cancer	DISVC52G	Strong	Biomarker	[2]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[2]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[1]
Cowden disease	DISMYKCE	Strong	Posttranslational Modification	[2]
Obesity	DIS47Y1K	Strong	Biomarker	[3]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[3]
Ulcerative colitis	DIS8K27O	Strong	Posttranslational Modification	[4]
Colorectal neoplasm	DISR1UCN	Disputed	Biomarker	[5]
Lung carcinoma	DISTR26C	Limited	Genetic Variation	[6]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transcription elongation regulator 1-like protein (TCERG1L).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transcription elongation regulator 1-like protein (TCERG1L).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Transcription elongation regulator 1-like protein (TCERG1L).	[12]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription elongation regulator 1-like protein (TCERG1L).	[8]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Transcription elongation regulator 1-like protein (TCERG1L).	[9]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Transcription elongation regulator 1-like protein (TCERG1L).	[9]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Transcription elongation regulator 1-like protein (TCERG1L).	[10]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Transcription elongation regulator 1-like protein (TCERG1L).	[13]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Transcription elongation regulator 1-like protein (TCERG1L).	[14]

References

• [1] DNA methylation biomarker candidates for early detection of colon cancer.Tumour Biol. 2012 Apr;33(2):363-72. doi: 10.1007/s13277-011-0302-2. Epub 2012 Jan 12.
• [2] Detection of DNA hypermethylation in sera of patients with Crohn's disease.Mol Med Rep. 2014 Feb;9(2):725-9. doi: 10.3892/mmr.2013.1840. Epub 2013 Dec 3.
• [3] Genome-wide association study identifies novel loci association with fasting insulin and insulin resistance in African Americans.Hum Mol Genet. 2012 Oct 15;21(20):4530-6. doi: 10.1093/hmg/dds282. Epub 2012 Jul 12.
• [4] DNA hypermethylation of a selective gene panel as a risk marker for colon cancer in patients with ulcerative colitis.Int J Mol Med. 2013 May;31(5):1255-61. doi: 10.3892/ijmm.2013.1317. Epub 2013 Mar 26.
• [5] Genomic and epigenomic integration identifies a prognostic signature in colon cancer.Clin Cancer Res. 2011 Mar 15;17(6):1535-45. doi: 10.1158/1078-0432.CCR-10-2509. Epub 2011 Jan 28.
• [6] Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [9] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [10] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [12] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [13] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [14] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.