Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSC2133)

DOT Name Lithostathine-1-beta (REG1B)
Synonyms Pancreatic stone protein 2; PSP-2; Regenerating islet-derived protein 1-beta; REG-1-beta; Regenerating protein I beta
Gene Name REG1B
Related Disease
Crohn disease ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Inflammatory bowel disease ( )
Intestinal disorder ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Matthew-Wood syndrome ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
Pancreatitis ( )
Squamous cell carcinoma ( )
Type-1/2 diabetes ( )
Type-1 diabetes ( )
UniProt ID
REG1B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00059
Sequence
MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDA
DLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVS
YKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN
Function Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Crohn disease DIS2C5Q8 Definitive Biomarker [1]
Colon cancer DISVC52G Strong Altered Expression [2]
Colon carcinoma DISJYKUO Strong Altered Expression [2]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [3]
Inflammatory bowel disease DISGN23E Strong Biomarker [4]
Intestinal disorder DISGPMUQ Strong Biomarker [5]
Lung adenocarcinoma DISD51WR Strong Biomarker [6]
Lung cancer DISCM4YA Strong Biomarker [6]
Lung carcinoma DISTR26C Strong Biomarker [6]
Matthew-Wood syndrome DISA7HR7 Strong Altered Expression [7]
Neoplasm DISZKGEW Strong Altered Expression [3]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [8]
Pancreatitis DIS0IJEF Strong Altered Expression [9]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [6]
Type-1/2 diabetes DISIUHAP Strong Altered Expression [9]
Type-1 diabetes DIS7HLUB moderate Biomarker [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Lithostathine-1-beta (REG1B). [11]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Lithostathine-1-beta (REG1B). [12]
------------------------------------------------------------------------------------

References

1 Characterization of intestinal gene expression profiles in Crohn's disease by genome-wide microarray analysis.Inflamm Bowel Dis. 2010 Oct;16(10):1717-28. doi: 10.1002/ibd.21263.
2 Candidate genes involved in metastasis of colon cancer identified by integrated analysis.Cancer Med. 2019 May;8(5):2338-2347. doi: 10.1002/cam4.2071. Epub 2019 Mar 18.
3 Regenerating gene 1B silencing inhibits colon cancer cell HCT116 proliferation and invasion.Int J Biol Markers. 2015 May 26;30(2):e217-25. doi: 10.5301/jbm.5000133.
4 Expression of human REG family genes in inflammatory bowel disease and their molecular mechanism.Immunol Res. 2018 Dec;66(6):800-805. doi: 10.1007/s12026-019-9067-2.
5 REG1B as a predictor of childhood stunting in Bangladesh and Peru.Am J Clin Nutr. 2013 May;97(5):1129-33. doi: 10.3945/ajcn.112.048306. Epub 2013 Apr 3.
6 REG I gene expression is linked with the poor prognosis of lung adenocarcinoma and squamous cell carcinoma patients via discrete mechanisms.Oncol Rep. 2013 Dec;30(6):2625-31. doi: 10.3892/or.2013.2739. Epub 2013 Sep 19.
7 Reg proteins promote acinar-to-ductal metaplasia and act as novel diagnostic and prognostic markers in pancreatic ductal adenocarcinoma.Oncotarget. 2016 Nov 22;7(47):77838-77853. doi: 10.18632/oncotarget.12834.
8 Structure and in vitro hypoglycemic activity of a homogenous polysaccharide purified from Sargassum pallidum.Food Funct. 2019 May 22;10(5):2828-2838. doi: 10.1039/c8fo02525h.
9 Reg2 Expression Is Required for Pancreatic Islet Compensation in Response to Aging and High-Fat Diet-Induced Obesity.Endocrinology. 2017 Jun 1;158(6):1634-1644. doi: 10.1210/en.2016-1551.
10 No abnormalities of reg1 alpha and reg1 beta gene associated with diabetes mellitus.Diabetes Res Clin Pract. 2002 Feb;55(2):105-11. doi: 10.1016/s0168-8227(01)00321-7.
11 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.