Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSJTAZP)

DOT Name Sushi domain-containing protein 2 (SUSD2)
Gene Name SUSD2
Related Disease
Advanced cancer ( )
Amyotrophic lateral sclerosis ( )
Breast neoplasm ( )
Clear cell renal carcinoma ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Renal cell carcinoma ( )
Coronary heart disease ( )
Gastric cancer ( )
Stomach cancer ( )
UniProt ID
SUSD2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF03782 ; PF00084 ; PF00094
Sequence
MKPALLPWALLLLATALGPGPGPTADAQESCSMRCGALDGPCSCHPTCSGLGTCCLDFRD
FCLEILPYSGSMMGGKDFVVRHFKMSSPTDASVICRFKDSIQTLGHVDSSGQVHCVSPLL
YESGRIPFTVSLDNGHSFPRAGTWLAVHPNKVSMMEKSELVNETRWQYYGTANTSGNLSL
TWHVKSLPTQTITIELWGYEETGMPYSQEWTAKWSYLYPLATHIPNSGSFTFTPKPAPPS
YQRWRVGALRIIDSKNYAGQKDVQALWTNDHALAWHLSDDFREDPVAWARTQCQAWEELE
DQLPNFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHCVRSVQASLRY
GSGQQCCYTADGTQLLTADSSGGSTPDRGHDWGAPPFRTPPRVPSMSHWLYDVLSFYYCC
LWAPDCPRYMQRRPSNDCRNYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAALTD
LRVQARAQPGTMSNGTETRGTGLTAVAVQEGNSDVVEVRLANRTGGLEVLLNQEVLSFTE
QSWMDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLN
NDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPT
FEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLSTGTATRVAHQLHQRRMQSLQ
PVVSCGWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETSTCQADGTWSSPTPKCQP
GRSYAVLLGIIFGGLAVVAAVALVYVLLRRRKGNTHVWGAQP
Function
May be a cytokine receptor for GPR15LG. May be a tumor suppressor; together with GPR15LG has a growth inhibitory effect on colon cancer cells which includes G1 cell cycle arrest. May play a role in breast tumorigenesis.
Tissue Specificity
Highly expressed in breast cancer, but shows a restricted expression pattern in normal tissues such as adipose, adrenal gland, kidney, lung, mammary gland, placenta, thyroid, trachea, and uterus . Also expressed in colon; down-regulated in colon cancer tissues .

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Amyotrophic lateral sclerosis DISF7HVM Strong Genetic Variation [2]
Breast neoplasm DISNGJLM Strong Biomarker [3]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [4]
Endometrial cancer DISW0LMR Strong Altered Expression [5]
Endometrial carcinoma DISXR5CY Strong Altered Expression [5]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [6]
Lung cancer DISCM4YA Strong Biomarker [4]
Lung carcinoma DISTR26C Strong Biomarker [4]
Neoplasm DISZKGEW Strong Biomarker [4]
Ovarian cancer DISZJHAP Strong Biomarker [6]
Ovarian neoplasm DISEAFTY Strong Biomarker [6]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [4]
Coronary heart disease DIS5OIP1 moderate Genetic Variation [7]
Gastric cancer DISXGOUK Limited Biomarker [8]
Stomach cancer DISKIJSX Limited Biomarker [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Sushi domain-containing protein 2 (SUSD2). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Sushi domain-containing protein 2 (SUSD2). [15]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Sushi domain-containing protein 2 (SUSD2). [10]
Triclosan DMZUR4N Approved Triclosan increases the expression of Sushi domain-containing protein 2 (SUSD2). [11]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Sushi domain-containing protein 2 (SUSD2). [12]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Sushi domain-containing protein 2 (SUSD2). [13]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Sushi domain-containing protein 2 (SUSD2). [14]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Sushi domain-containing protein 2 (SUSD2). [13]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Sushi domain-containing protein 2 (SUSD2). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 SUSD2 promotes cancer metastasis and confers cisplatin resistance in high grade serous ovarian cancer.Exp Cell Res. 2018 Feb 15;363(2):160-170. doi: 10.1016/j.yexcr.2017.12.029. Epub 2018 Jan 2.
2 Genome-wide association analyses in Han Chinese identify two new susceptibility loci for amyotrophic lateral sclerosis.Nat Genet. 2013 Jun;45(6):697-700. doi: 10.1038/ng.2627. Epub 2013 Apr 28.
3 SUSD2 promotes tumor-associated macrophage recruitment by increasing levels of MCP-1 in breast cancer.PLoS One. 2017 May 5;12(5):e0177089. doi: 10.1371/journal.pone.0177089. eCollection 2017.
4 SUSD2 is frequently downregulated and functions as a tumor suppressor in RCC and lung cancer.Tumour Biol. 2016 Jul;37(7):9919-30. doi: 10.1007/s13277-015-4734-y. Epub 2016 Jan 27.
5 Downregulation of endometrial mesenchymal marker SUSD2 causes cell senescence and cell death in endometrial carcinoma cells.PLoS One. 2017 Aug 25;12(8):e0183681. doi: 10.1371/journal.pone.0183681. eCollection 2017.
6 Sushi Domain Containing 2 (SUSD2) inhibits platelet activation and binding to high-grade serous ovarian carcinoma cells.Platelets. 2018 Dec;29(8):834-837. doi: 10.1080/09537104.2018.1530345. Epub 2018 Oct 18.
7 Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
8 Expression of sushi domain containing two reflects the malignant potential of gastric cancer.Cancer Med. 2018 Oct;7(10):5194-5204. doi: 10.1002/cam4.1793. Epub 2018 Sep 27.
9 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
10 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
13 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
14 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
15 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
16 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.