Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSQQ37P)

DOT Name TRPM8 channel-associated factor 1 (TCAF1)
Synonyms TRP channel-associated factor 1
Gene Name TCAF1
Related Disease
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
TCAF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF17291 ; PF13402
Sequence
MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLV
VVSHEDYLVEAQLTPFLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKD
SLGVYCIDAYNETMTEKLVKFMKCGGGLLIGGQAWDWANQGEDERVLFTFPGNLVTSVAG
IYFTDNKGDTSFFKVSKKMPKIPVLVSCEDDLSDDREELLHGISELDISNSDCFPSQLLV
HGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRRGK
VVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVG
AQAWWWAFKNPGVSPLARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAE
FQVIMGRKRGNVEKGWLAKLGPDGAAFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRE
NPVINDCCRGAMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPSESPITVEVNCTNPGT
RYCWMSTGLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLD
KPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGP
WGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQI
SVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCN
LWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWNAWTALETYLQLQEAF
GWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSL
AYLPEWKENIMKLYLLTQMPH
Function
Positively regulates the plasma membrane cation channel TRPM8 activity. Involved in the recruitment of TRPM8 to the cell surface. Promotes prostate cancer cell migration inhibition in a TRPM8-dependent manner.
Tissue Specificity Isoform 2 is expressed in the prostate and strongly expressed in cancerous prostate samples.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Prostate cancer DISF190Y Strong Biomarker [1]
Prostate carcinoma DISMJPLE Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of TRPM8 channel-associated factor 1 (TCAF1). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of TRPM8 channel-associated factor 1 (TCAF1). [15]
------------------------------------------------------------------------------------
20 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of TRPM8 channel-associated factor 1 (TCAF1). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of TRPM8 channel-associated factor 1 (TCAF1). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [8]
Selenium DM25CGV Approved Selenium decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [9]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [10]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of TRPM8 channel-associated factor 1 (TCAF1). [11]
Clozapine DMFC71L Approved Clozapine decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [12]
Benzatropine DMF7EXL Approved Benzatropine decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [12]
Haloperidol DM96SE0 Approved Haloperidol decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [12]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of TRPM8 channel-associated factor 1 (TCAF1). [13]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [14]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of TRPM8 channel-associated factor 1 (TCAF1). [16]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of TRPM8 channel-associated factor 1 (TCAF1). [17]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of TRPM8 channel-associated factor 1 (TCAF1). [18]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of TRPM8 channel-associated factor 1 (TCAF1). [19]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of TRPM8 channel-associated factor 1 (TCAF1). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Drug(s)

References

1 RHCG and TCAF1 promoter hypermethylation predicts biochemical recurrence in prostate cancer patients treated by radical prostatectomy.Oncotarget. 2017 Jan 24;8(4):5774-5788. doi: 10.18632/oncotarget.14391.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
7 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
10 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
11 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
12 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
13 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
14 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
15 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
16 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
17 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
18 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
19 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
20 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.