Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSTMP0X)

• DOT Name: Mucin-7 (MUC7)
• Synonyms: MUC-7; Apo-MG2; Salivary mucin-7
• Gene Name: MUC7
• Related Disease:
  Adenocarcinoma
  Advanced cancer
  Bladder cancer
  Cerebellar ataxia, intellectual disability, and dysequilibrium syndrome 1
  Chronic kidney disease
  Chronic pancreatitis
  Colorectal carcinoma
  Craniosynostosis
  Cystic fibrosis
  Ductal carcinoma
  Keratoconjunctivitis sicca
  Laryngitis
  Pancreatic adenocarcinoma
  Squamous cell carcinoma
  Transitional cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Urinary tract infection
  Vasomotor/allergic rhinitis
  Endocarditis
• UniProt ID: MUC7_HUMAN
• Sequence:
  MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIR
  KSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSAS
  TKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPP
  SSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPT
  PSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAP
  QETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFL
  LYMKNLLNRIIDDMVEQ
• Function: May function in a protective capacity by promoting the clearance of bacteria in the oral cavity and aiding in mastication, speech, and swallowing. Binds P.aeruginosa pili.
• Tissue Specificity: Expressed in salivary gland tissues and only in those that contain mucous acinar cells (e.g. sublingual and submandibular glands) and not in salivary glands containing only serous acinar cells (e.g. parotid gland).
• KEGG Pathway: Salivary secretion (hsa04970)
• Reactome Pathway:
  Defective C1GALT1C1 causes TNPS (R-HSA-5083632)
  Defective GALNT12 causes CRCS1 (R-HSA-5083636)
  Dectin-2 family (R-HSA-5621480)
  O-linked glycosylation of mucins (R-HSA-913709)
  Termination of O-glycan biosynthesis (R-HSA-977068)
  Defective GALNT3 causes HFTC (R-HSA-5083625)

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[2]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[3]
Cerebellar ataxia, intellectual disability, and dysequilibrium syndrome 1	DISBHBD6	Strong	Biomarker	[4]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[5]
Chronic pancreatitis	DISBUOMJ	Strong	Altered Expression	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[2]
Craniosynostosis	DIS6J405	Strong	Altered Expression	[6]
Cystic fibrosis	DIS2OK1Q	Strong	Altered Expression	[7]
Ductal carcinoma	DIS15EA5	Strong	Biomarker	[1]
Keratoconjunctivitis sicca	DISNOENH	Strong	Biomarker	[4]
Laryngitis	DISX7UUD	Strong	Altered Expression	[8]
Pancreatic adenocarcinoma	DISKHX7S	Strong	Biomarker	[1]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[9]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[10]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[3]
Urinary tract infection	DISMT6UV	Strong	Altered Expression	[11]
Vasomotor/allergic rhinitis	DISHSTQ0	Strong	Altered Expression	[12]
Endocarditis	DISBU610	Disputed	Biomarker	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Mucin-7 (MUC7).	[14]

References

• [1] Mucin expression pattern in pancreatic diseases: findings from EUS-guided fine-needle aspiration biopsies.Am J Gastroenterol. 2011 Jul;106(7):1359-63. doi: 10.1038/ajg.2011.22. Epub 2011 Jun 7.
• [2] Frameshift mutations of MUC15 gene in gastric and its regional heterogeneity in gastric and colorectal cancers.Pathol Oncol Res. 2015 Jul;21(3):713-8. doi: 10.1007/s12253-014-9878-3. Epub 2015 Jan 9.
• [3] The value of combined use of survivin, cytokeratin 20 and mucin 7 mRNA for bladder cancer detection in voided urine.J Cancer Res Clin Oncol. 2008 Jun;134(6):659-65. doi: 10.1007/s00432-007-0331-9. Epub 2007 Nov 20.
• [4] Ocular mucin gene expression levels as biomarkers for the diagnosis of dry eye syndrome.Invest Ophthalmol Vis Sci. 2011 Oct 28;52(11):8363-9. doi: 10.1167/iovs.11-7655.
• [5] Identification of salivary peptidomic biomarkers in chronic kidney disease patients undergoing haemodialysis.Clin Chim Acta. 2019 Feb;489:154-161. doi: 10.1016/j.cca.2018.12.003. Epub 2018 Dec 7.
• [6] Aberrant mucin glycoprotein patterns of chronic rhinosinusitis patients with bacterial biofilms.Am J Rhinol Allergy. 2010 Sep-Oct;24(5):319-24. doi: 10.2500/ajra.2010.24.3504.
• [7] MUC5B and MUC7 are differentially expressed in mucous and serous cells of submucosal glands in human bronchial airways.Am J Respir Cell Mol Biol. 1998 Jul;19(1):30-7. doi: 10.1165/ajrcmb.19.1.3054.
• [8] Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.Ann Otol Rhinol Laryngol. 2008 Sep;117(9):688-95. doi: 10.1177/000348940811700911.
• [9] From normal respiratory mucosa to epidermoid carcinoma: expression of human mucin genes.Int J Cancer. 2000 Apr 15;86(2):162-8. doi: 10.1002/(sici)1097-0215(20000415)86:2<162::aid-ijc3>3.0.co;2-r.
• [10] Detection of mucin 7 gene expression in exfoliated cells in urine from patients with bladder tumor.Urology. 2003 Jul;62(1):182-6. doi: 10.1016/s0090-4295(03)00238-3.
• [11] Detection of circulating MUC7-positive cells by reverse transcription-polymerase chain reaction in bladder cancer patients.Int J Urol. 2004 Jan;11(1):38-43. doi: 10.1111/j.1442-2042.2004.00739.x.
• [12] Mucin mRNA expression in normal and vasomotor inferior turbinates.Am J Rhinol. 1997 Jul-Aug;11(4):293-302. doi: 10.2500/105065897781446685.
• [13] Streptococcal Siglec-like adhesins recognize different subsets of human plasma glycoproteins: implications for infective endocarditis.Glycobiology. 2018 Aug 1;28(8):601-611. doi: 10.1093/glycob/cwy052.
• [14] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.