Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSXW7EW)

• DOT Name: Tetraspanin-32 (TSPAN32)
• Synonyms: Tspan-32; Protein Phemx
• Gene Name: TSPAN32
• Related Disease:
  Tuberculosis
  Autism
  Autoimmune disease
  Immunodeficiency
  Multiple sclerosis
  Nervous system inflammation
• UniProt ID: TSN32_HUMAN
• Pfam ID: PF00335
• Sequence:
  MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW
  AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE
  DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
  EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR
  ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR
  ALQGRSRGGLSGCPERGLSD
• Tissue Specificity: Expressed ubiquitously at low levels. High levels of expression are confined to hematopoietic tissues including peripheral blood leukocytes, thymus and spleen.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[1]
Autism	DISV4V1Z	Strong	Biomarker	[2]
Autoimmune disease	DISORMTM	Strong	Biomarker	[3]
Immunodeficiency	DIS093I0	Strong	Biomarker	[4]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[3]
Nervous system inflammation	DISB3X5A	Strong	Altered Expression	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Tetraspanin-32 (TSPAN32).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Tetraspanin-32 (TSPAN32).	[9]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Tetraspanin-32 (TSPAN32).	[6]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Tetraspanin-32 (TSPAN32).	[7]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Tetraspanin-32 (TSPAN32).	[8]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Tetraspanin-32 (TSPAN32).	[10]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Tetraspanin-32 (TSPAN32).	[11]

References

• [1] Micronutrient supplementation in adults with HIV infection.Cochrane Database Syst Rev. 2017 May 18;5(5):CD003650. doi: 10.1002/14651858.CD003650.pub4.
• [2] DNA methylation analysis of the autistic brain reveals multiple dysregulated biological pathways.Transl Psychiatry. 2014 Sep 2;4(9):e433. doi: 10.1038/tp.2014.70.
• [3] Modulation of Tetraspanin 32 (TSPAN32) Expression in T Cell-Mediated Immune Responses and in Multiple Sclerosis.Int J Mol Sci. 2019 Sep 4;20(18):4323. doi: 10.3390/ijms20184323.
• [4] Does antiretroviral treatment increase the infectiousness of smear-positive pulmonary tuberculosis?.Int J Tuberc Lung Dis. 2017 Nov 1;21(11):1147-1154. doi: 10.5588/ijtld.17.0162.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [7] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [8] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [11] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.