Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUL3PSA)

• DOT Name: Apoptosis-enhancing nuclease (AEN)
• Synonyms: EC 3.1.-.-; Interferon-stimulated 20 kDa exonuclease-like 1
• Gene Name: AEN
• UniProt ID: AEN_HUMAN
• EC Number: 3.1.-.-
• Pfam ID: PF00929
• Sequence:
  MVPREAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPG
  SSPLPTPFGAATATEAASSGKQCLRAGSGSAPCSRRPAPGKASGPLPSKCVAIDCEMVGT
  GPRGRVSELARCSIVSYHGNVLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKE
  ILKLLKGKVVVGHALHNDFQALKYVHPRSQTRDTTYVPNFLSEPGLHTRARVSLKDLALQ
  LLHKKIQVGQHGHSSVEDATTAMELYRLVEVQWEQQEARSLWTCPEDREPDSSTDMEQYM
  EDQYWPDDLAHGSRGGAREAQDRRN
• Function: Exonuclease with activity against single- and double-stranded DNA and RNA. Mediates p53-induced apoptosis. When induced by p53 following DNA damage, digests double-stranded DNA to form single-stranded DNA and amplifies DNA damage signals, leading to enhancement of apoptosis.

Molecular Interaction Atlas (MIA) of This DOT

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Apoptosis-enhancing nuclease (AEN).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Apoptosis-enhancing nuclease (AEN).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Apoptosis-enhancing nuclease (AEN).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Apoptosis-enhancing nuclease (AEN).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Apoptosis-enhancing nuclease (AEN).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Apoptosis-enhancing nuclease (AEN).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Apoptosis-enhancing nuclease (AEN).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Apoptosis-enhancing nuclease (AEN).	[8]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Apoptosis-enhancing nuclease (AEN).	[9]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Apoptosis-enhancing nuclease (AEN).	[10]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Apoptosis-enhancing nuclease (AEN).	[11]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Apoptosis-enhancing nuclease (AEN).	[12]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Apoptosis-enhancing nuclease (AEN).	[13]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Apoptosis-enhancing nuclease (AEN).	[14]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Apoptosis-enhancing nuclease (AEN).	[15]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Apoptosis-enhancing nuclease (AEN).	[17]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Apoptosis-enhancing nuclease (AEN).	[18]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Apoptosis-enhancing nuclease (AEN).	[19]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Apoptosis-enhancing nuclease (AEN).	[20]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Apoptosis-enhancing nuclease (AEN).	[21]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Apoptosis-enhancing nuclease (AEN).	[16]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Systematic transcriptome-based comparison of cellular adaptive stress response activation networks in hepatic stem cell-derived progeny and primary human hepatocytes. Toxicol In Vitro. 2021 Jun;73:105107. doi: 10.1016/j.tiv.2021.105107. Epub 2021 Feb 3.
• [7] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [10] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [11] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [12] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [13] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [14] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [15] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [16] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [17] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [18] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [19] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [20] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [21] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.