Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUP9MS4)

• DOT Name: AT-rich interactive domain-containing protein 3B (ARID3B)
• Synonyms: ARID domain-containing protein 3B; Bright and dead ringer protein; Bright-like protein
• Gene Name: ARID3B
• Related Disease:
  Neoplasm
  Advanced cancer
  Atrial fibrillation
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Carcinoma
  Craniofacial microsomia
  Epithelial ovarian cancer
  Gastric neoplasm
  Isolated cleft lip
  Ovarian cancer
  Ovarian neoplasm
  Pneumonia
  Retinoblastoma
  Schizoaffective disorder
  Endometriosis
  Neuroblastoma
  Bipolar I disorder
  Psychotic disorder
  Breast neoplasm
  Head and neck cancer
  Head and neck carcinoma
  Invasive breast carcinoma
  Kaposi sarcoma
  Schizophrenia
• UniProt ID: ARI3B_HUMAN
• Pfam ID: PF01388
• Sequence:
  MEPLQQQQQQQQQQQKQPHLAPLQMDAREKQGQQMREAQFLYAQKLVTQPTLLSATAGRP
  SGSTPLGPLARVPPTAAVAQVFERGNMNSEPEEEDGGLEDEDGDDEVAEVAEKETQAASK
  YFHVQKVARQDPRVAPMSNLLPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDE
  QLKQNGGLAWSDDADGGRGREISRDFAKLYELDGDPERKEFLDDLFVFMQKRGTPINRIP
  IMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLY
  AYECEKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAATAAAAAGAPALLSPPKI
  RFPILGLGSSSGTNTSSPRISPATTLRKGDGAPVTTVPVPNRLAVPVTLASQQAGTRTAA
  LEQLRERLESGEPAEKKASRLSEEEQRLVQQAFQRNFFSMARQLPMKIRINGRAEDRAEA
  SAAALNLTTSSIGSINMSVDIDGTTYAGVLFAQKPVVHLITGSAPQSLGSSASSSSSSHC
  SPSPTSSRGTPSAEPSTSWSL
• Function: Transcription factor which may be involved in neuroblastoma growth and malignant transformation. Favors nuclear targeting of ARID3A.
• Tissue Specificity: Expressed in placenta, testis and leukocytes. Expressed in neuroblastoma. Present in K-562 erythrocytic leukemia cell line (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[3]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Carcinoma	DISH9F1N	Strong	Altered Expression	[6]
Craniofacial microsomia	DISYHJ2P	Strong	Genetic Variation	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[1]
Gastric neoplasm	DISOKN4Y	Strong	Altered Expression	[6]
Isolated cleft lip	DIS2O2JV	Strong	Genetic Variation	[8]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[1]
Pneumonia	DIS8EF3M	Strong	Genetic Variation	[3]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[9]
Schizoaffective disorder	DISLBW6B	Strong	Biomarker	[4]
Endometriosis	DISX1AG8	moderate	Genetic Variation	[10]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[6]
Bipolar I disorder	DISD09EH	Disputed	Biomarker	[11]
Psychotic disorder	DIS4UQOT	Disputed	Genetic Variation	[11]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[5]
Head and neck cancer	DISBPSQZ	Limited	Biomarker	[2]
Head and neck carcinoma	DISOU1DS	Limited	Biomarker	[2]
Invasive breast carcinoma	DISANYTW	Limited	Altered Expression	[5]
Kaposi sarcoma	DISC1H1Z	Limited	Biomarker	[12]
Schizophrenia	DISSRV2N	Limited	Biomarker	[4]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of AT-rich interactive domain-containing protein 3B (ARID3B).	[13]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of AT-rich interactive domain-containing protein 3B (ARID3B).	[14]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of AT-rich interactive domain-containing protein 3B (ARID3B).	[15]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of AT-rich interactive domain-containing protein 3B (ARID3B).	[16]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of AT-rich interactive domain-containing protein 3B (ARID3B).	[17]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of AT-rich interactive domain-containing protein 3B (ARID3B).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of AT-rich interactive domain-containing protein 3B (ARID3B).	[20]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of AT-rich interactive domain-containing protein 3B (ARID3B).	[19]

References

• [1] ARID3B Directly Regulates Ovarian Cancer Promoting Genes.PLoS One. 2015 Jun 29;10(6):e0131961. doi: 10.1371/journal.pone.0131961. eCollection 2015.
• [2] let-7 Modulates Chromatin Configuration and Target Gene Repression through Regulation of the ARID3B Complex.Cell Rep. 2016 Jan 26;14(3):520-533. doi: 10.1016/j.celrep.2015.12.064. Epub 2016 Jan 14.
• [3] Extrafine inhaled triple therapy versus dual bronchodilator therapy in chronic obstructive pulmonary disease (TRIBUTE): a double-blind, parallel group, randomised controlled trial.Lancet. 2018 Mar 17;391(10125):1076-1084. doi: 10.1016/S0140-6736(18)30206-X. Epub 2018 Feb 9.
• [4] A Bayesian model comparison approach to test the specificity of visual integration impairment in schizophrenia or psychosis.Psychiatry Res. 2018 Jul;265:271-278. doi: 10.1016/j.psychres.2018.04.061. Epub 2018 May 7.
• [5] ARID3B expression in primary breast cancers and breast cancer-derived cell lines.Cell Oncol (Dordr). 2014 Aug;37(4):289-96. doi: 10.1007/s13402-014-0185-5. Epub 2014 Aug 14.
• [6] Differential expression of ARID3B in normal adult tissue and carcinomas.Gene. 2014 Jun 10;543(1):174-80. doi: 10.1016/j.gene.2014.04.007. Epub 2014 Apr 3.
• [7] Genome-wide association study identifies multiple susceptibility loci for craniofacial microsomia.Nat Commun. 2016 Feb 8;7:10605. doi: 10.1038/ncomms10605.
• [8] Genome-wide meta-analyses of nonsyndromic orofacial clefts identify novel associations between FOXE1 and all orofacial clefts, and TP63 and cleft lip with or without cleft palate.Hum Genet. 2017 Mar;136(3):275-286. doi: 10.1007/s00439-016-1754-7. Epub 2017 Jan 4.
• [9] Bdp, a new member of a family of DNA-binding proteins, associates with the retinoblastoma gene product.Cancer Res. 1999 Aug 1;59(15):3741-7.
• [10] New variants near RHOJ and C2, HLA-DRA region and susceptibility to endometriosis in the Polish population-The genome-wide association study.Eur J Obstet Gynecol Reprod Biol. 2017 Oct;217:106-112. doi: 10.1016/j.ejogrb.2017.08.037. Epub 2017 Sep 1.
• [11] Electrophysiological correlates of emotional scene processing in bipolar disorder.J Psychiatr Res. 2020 Jan;120:83-90. doi: 10.1016/j.jpsychires.2019.10.005. Epub 2019 Oct 8.
• [12] ARID3B: a Novel Regulator of the Kaposi's Sarcoma-Associated Herpesvirus Lytic Cycle.J Virol. 2016 Sep 29;90(20):9543-55. doi: 10.1128/JVI.03262-15. Print 2016 Oct 15.
• [13] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [14] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [15] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [16] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [17] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [18] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [19] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [20] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.