Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVAGUOV)

DOT Name Protein FAM13C (FAM13C)
Gene Name FAM13C
Related Disease
Advanced cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
FA13C_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MFSCFCFSLQDNSFSSTTVTECDEDPVSLHEDQTDCSSLRDENNKENYPDAGALVEEHAP
PSWEPQQQNVEATVLVDSVLRPSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSEC
QVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKDAFETRQDLNEEEAAQVHGVKD
PAPASTQSVLADGTDSADPSPVHKDGQNEADSAPEDLHSVGTSRLLYHITDGDNPLLSPR
CSIFSQSQRFNLDPESAPSPPSTQQFMMPRSSSRCSCGDGKEPQTITQLTKHIQSLKRKI
RKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKELKLKLSEEQGSAPKGPPR
NLLCEQPTVPRENGKPEAAGPEPSSSGEETPDAALTCLKERREQLPPQEDSKVTKQDKNL
IKPLYDRYRIIKQILSTPSLIPTIQEEEDSDEDRPQGSQQPSLADPASHLPVGDHLTYSN
ETEPVRALLPDEKKEVKPPALSMSNLHEATMPVLLDHLRETRADKKRLRKALREFEEQFF
KQTGRSPQKEDRIPMADEYYEYKHIKAKLRLLEVLISKQDVAKTI

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Prostate cancer DISF190Y Strong Altered Expression [1]
Prostate carcinoma DISMJPLE Strong Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
16 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Protein FAM13C (FAM13C). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Protein FAM13C (FAM13C). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Protein FAM13C (FAM13C). [4]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Protein FAM13C (FAM13C). [5]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Protein FAM13C (FAM13C). [6]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Protein FAM13C (FAM13C). [7]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Protein FAM13C (FAM13C). [8]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Protein FAM13C (FAM13C). [7]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Protein FAM13C (FAM13C). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Protein FAM13C (FAM13C). [10]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Protein FAM13C (FAM13C). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Protein FAM13C (FAM13C). [3]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Protein FAM13C (FAM13C). [12]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Protein FAM13C (FAM13C). [13]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Protein FAM13C (FAM13C). [14]
OXYQUINOLINE DMZVS9Y Investigative OXYQUINOLINE decreases the expression of Protein FAM13C (FAM13C). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Drug(s)

References

1 Family with sequence similarity 13C (FAM13C) overexpression is an independent prognostic marker in prostate cancer.Oncotarget. 2017 May 9;8(19):31494-31508. doi: 10.18632/oncotarget.16357.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
7 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
8 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
9 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
12 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
13 Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
14 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.