Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX7MWW1)

DOT Name Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1)
Synonyms IP3 receptor isoform 1; IP3R 1; InsP3R1; Type 1 inositol 1,4,5-trisphosphate receptor; Type 1 InsP3 receptor
Gene Name ITPR1
Related Disease
Aniridia-cerebellar ataxia-intellectual disability syndrome ( )
Spinocerebellar ataxia type 29 ( )
Spinocerebellar ataxia type 15/16 ( )
UniProt ID
ITPR1_HUMAN
Pfam ID
PF08709 ; PF00520 ; PF02815 ; PF08454 ; PF01365
Sequence
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQE
SASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIK
FLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCY
VDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFF
SSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAI
PVDLDSQVNNLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKL
CIKVLQTLREMMTKDRGYGEKLISIDELDNAELPPAPDSENATEELEPSPPLRQLEDHKR
GEALRQVLVNRYYGNVRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGSGSSSMSRGEMSL
AEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKK
SEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEV
RDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRF
LQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVAL
INQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNA
SKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNV
GHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPV
PSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARN
MSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHG
IRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEF
LYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILV
YLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPRE
ELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLL
FFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI
KEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQ
NELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
Function
Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate. Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1. Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways.
Tissue Specificity Widely expressed.
KEGG Pathway
Calcium sig.ling pathway (hsa04020 )
cGMP-PKG sig.ling pathway (hsa04022 )
Phosphatidylinositol sig.ling system (hsa04070 )
Oocyte meiosis (hsa04114 )
Autophagy - animal (hsa04140 )
Apoptosis (hsa04210 )
Cellular senescence (hsa04218 )
Vascular smooth muscle contraction (hsa04270 )
Apelin sig.ling pathway (hsa04371 )
Osteoclast differentiation (hsa04380 )
Gap junction (hsa04540 )
Platelet activation (hsa04611 )
NOD-like receptor sig.ling pathway (hsa04621 )
C-type lectin receptor sig.ling pathway (hsa04625 )
Circadian entrainment (hsa04713 )
Long-term potentiation (hsa04720 )
Retrograde endocan.binoid sig.ling (hsa04723 )
Glutamatergic sy.pse (hsa04724 )
Cholinergic sy.pse (hsa04725 )
Serotonergic sy.pse (hsa04726 )
Dopaminergic sy.pse (hsa04728 )
Long-term depression (hsa04730 )
Inflammatory mediator regulation of TRP channels (hsa04750 )
GnRH sig.ling pathway (hsa04912 )
Estrogen sig.ling pathway (hsa04915 )
Thyroid hormone synthesis (hsa04918 )
Oxytocin sig.ling pathway (hsa04921 )
Glucagon sig.ling pathway (hsa04922 )
Renin secretion (hsa04924 )
Aldosterone synthesis and secretion (hsa04925 )
Cortisol synthesis and secretion (hsa04927 )
Parathyroid hormone synthesis, secretion and action (hsa04928 )
GnRH secretion (hsa04929 )
Cushing syndrome (hsa04934 )
Growth hormone synthesis, secretion and action (hsa04935 )
Salivary secretion (hsa04970 )
Gastric acid secretion (hsa04971 )
Pancreatic secretion (hsa04972 )
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Huntington disease (hsa05016 )
Spinocerebellar ataxia (hsa05017 )
Prion disease (hsa05020 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Shigellosis (hsa05131 )
Human cytomegalovirus infection (hsa05163 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Human immunodeficiency virus 1 infection (hsa05170 )
Proteoglycans in cancer (hsa05205 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Effects of PIP2 hydrolysis (R-HSA-114508 )
Elevation of cytosolic Ca2+ levels (R-HSA-139853 )
DAG and IP3 signaling (R-HSA-1489509 )
Role of phospholipids in phagocytosis (R-HSA-2029485 )
FCERI mediated Ca+2 mobilization (R-HSA-2871809 )
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion (R-HSA-381676 )
Ca2+ pathway (R-HSA-4086398 )
cGMP effects (R-HSA-418457 )
Regulation of insulin secretion (R-HSA-422356 )
VEGFR2 mediated cell proliferation (R-HSA-5218921 )
Ion homeostasis (R-HSA-5578775 )
CLEC7A (Dectin-1) induces NFAT activation (R-HSA-5607763 )
FCGR3A-mediated IL10 synthesis (R-HSA-9664323 )
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695 )
PLC beta mediated events (R-HSA-112043 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Aniridia-cerebellar ataxia-intellectual disability syndrome DIS4QZ3S Definitive Autosomal dominant [1]
Spinocerebellar ataxia type 29 DISAST24 Definitive Autosomal dominant [1]
Spinocerebellar ataxia type 15/16 DISTNCLR Strong Autosomal dominant [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Etoposide DMNH3PG Approved Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) affects the response to substance of Etoposide. [35]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [3]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [8]
Procaine DM4LSNE Approved Procaine increases the phosphorylation of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [22]
TAK-243 DM4GKV2 Phase 1 TAK-243 affects the sumoylation of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [29]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [32]
------------------------------------------------------------------------------------
32 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [9]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [12]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [13]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [12]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [14]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [15]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [16]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [17]
Ethanol DMDRQZU Approved Ethanol increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [18]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [19]
Dasatinib DMJV2EK Approved Dasatinib increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [20]
Bexarotene DMOBIKY Approved Bexarotene increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [21]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [23]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [24]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [16]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [25]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [26]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [27]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [28]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [30]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [25]
EMODIN DMAEDQG Terminated EMODIN decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [31]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [33]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [17]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [7]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1). [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 32 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Deletion at ITPR1 underlies ataxia in mice and spinocerebellar ataxia 15 in humans. PLoS Genet. 2007 Jun;3(6):e108. doi: 10.1371/journal.pgen.0030108. Epub 2007 May 16.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
5 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
8 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
11 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
12 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
13 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
14 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
15 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
16 Influence of resveratrol on rheumatoid fibroblast-like synoviocytes analysed with gene chip transcription. Phytomedicine. 2013 Feb 15;20(3-4):310-8. doi: 10.1016/j.phymed.2012.09.020. Epub 2012 Nov 6.
17 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
18 Alcohol-induced blood-brain barrier dysfunction is mediated via inositol 1,4,5-triphosphate receptor (IP3R)-gated intracellular calcium release. J Neurochem. 2007 Jan;100(2):324-36. doi: 10.1111/j.1471-4159.2006.04245.x.
19 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
20 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
21 Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
22 H(1)R mediates local anesthetic-induced vascular permeability in angioedema. Toxicol Appl Pharmacol. 2020 Apr 1;392:114921. doi: 10.1016/j.taap.2020.114921. Epub 2020 Feb 12.
23 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
24 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
25 Caffeine overcomes genistein-induced G2/M cell cycle arrest in breast cancer cells. Nutr Cancer. 2008;60(3):382-8.
26 Emptying of intracellular calcium pool and oxidative stress imbalance are associated with the glyphosate-induced proliferation in human skin keratinocytes HaCaT cells. ISRN Dermatol. 2013 Aug 29;2013:825180.
27 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
28 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
29 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
30 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
31 Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
32 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
33 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
34 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
35 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.