Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXHN86R)

• DOT Name: Interleukin-11 (IL11)
• Synonyms: IL-11; Adipogenesis inhibitory factor; AGIF; Oprelvekin
• Gene Name: IL11
• Related Disease: Craniosynostosis and dental anomalies
• UniProt ID: IL11_HUMAN
• PDB ID: 4MHL; 6O4O; 8DPS; 8DPT; 8DPU; 8DPV; 8DPW
• Pfam ID: PF07400
• Sequence:
  MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
  RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
  TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
  LHLTLDWAVRGLLLLKTRL
• Function: Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  JAK-STAT sig.ling pathway (hsa04630)
  Hematopoietic cell lineage (hsa04640)
  Rheumatoid arthritis (hsa05323)
• Reactome Pathway: IL-6-type cytokine receptor ligand interactions (R-HSA-6788467)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Craniosynostosis and dental anomalies	DISNSW0F	Limited	Autosomal recessive	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Interleukin-11 (IL11).	[2]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Interleukin-11 (IL11).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interleukin-11 (IL11).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Interleukin-11 (IL11).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Interleukin-11 (IL11).	[6]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Interleukin-11 (IL11).	[7]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Interleukin-11 (IL11).	[8]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Interleukin-11 (IL11).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Interleukin-11 (IL11).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Interleukin-11 (IL11).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Interleukin-11 (IL11).	[12]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Interleukin-11 (IL11).	[13]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Interleukin-11 (IL11).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Interleukin-11 (IL11).	[15]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Interleukin-11 (IL11).	[16]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Interleukin-11 (IL11).	[17]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Interleukin-11 (IL11).	[18]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Interleukin-11 (IL11).	[19]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Interleukin-11 (IL11).	[20]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Interleukin-11 (IL11).	[21]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Interleukin-11 (IL11).	[22]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Interleukin-11 (IL11).	[23]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Interleukin-11 (IL11).	[24]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Interleukin-11 (IL11).	[25]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Interleukin-11 (IL11).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Interleukin-11 (IL11).	[27]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Interleukin-11 (IL11).	[28]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Interleukin-11 (IL11).	[29]
JWH-015	DMGTSCP	Patented	JWH-015 increases the expression of Interleukin-11 (IL11).	[30]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Interleukin-11 (IL11).	[31]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Interleukin-11 (IL11).	[32]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Interleukin-11 (IL11).	[33]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Interleukin-11 (IL11).	[34]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Interleukin-11 (IL11).	[35]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Interleukin-11 (IL11).	[36]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Interleukin-11 (IL11).	[26]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of Interleukin-11 (IL11).	[37]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid increases the expression of Interleukin-11 (IL11).	[27]

References

• [1] Inactivation of IL11 signaling causes craniosynostosis, delayed tooth eruption, and supernumerary teeth. Am J Hum Genet. 2011 Jul 15;89(1):67-81. doi: 10.1016/j.ajhg.2011.05.024.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
• [8] Pattern of expression of apoptosis and inflammatory genes in humans exposed to arsenic and/or fluoride. Sci Total Environ. 2010 Jan 15;408(4):760-7. doi: 10.1016/j.scitotenv.2009.11.016. Epub 2009 Dec 4.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Darinaparsin: solid tumor hypoxic cytotoxin and radiosensitizer. Clin Cancer Res. 2012 Jun 15;18(12):3366-76.
• [12] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [13] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [14] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [15] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [16] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [17] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [18] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [19] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [20] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [21] Heme oxygenase-1 and interleukin-11 are overexpressed in stress-induced premature senescence of human WI-38 fibroblasts induced by tert-butylhydroperoxide and ethanol. Biogerontology. 2007 Aug;8(4):409-22. doi: 10.1007/s10522-007-9084-8. Epub 2007 Feb 13.
• [22] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [23] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [24] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [25] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [26] MAPK- and PKC/CREB-dependent induction of interleukin-11 by the environmental contaminant formaldehyde in human bronchial epithelial cells. Toxicology. 2012 Feb 6;292(1):13-22. doi: 10.1016/j.tox.2011.11.011. Epub 2011 Nov 28.
• [27] Induction of fibroblast growth factor-9 and interleukin-1alpha gene expression by motorcycle exhaust particulate extracts and benzo(a)pyrene in human lung adenocarcinoma cells. Toxicol Sci. 2005 Oct;87(2):483-96. doi: 10.1093/toxsci/kfi251. Epub 2005 Jul 7.
• [28] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [29] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [30] Alcohol and Cannabinoids Differentially Affect HIV Infection and Function of Human Monocyte-Derived Dendritic Cells (MDDC). Front Microbiol. 2015 Dec 22;6:1452. doi: 10.3389/fmicb.2015.01452. eCollection 2015.
• [31] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [32] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [33] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [34] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [35] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [36] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
• [37] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.