Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXW0WXJ)

• DOT Name: Glycosyltransferase 1 domain-containing protein 1 (GLT1D1)
• Synonyms: EC 2.4.-.-
• Gene Name: GLT1D1
• Related Disease:
  Systemic lupus erythematosus
  Asthma
• UniProt ID: GL1D1_HUMAN
• EC Number: 2.4.-.-
• Pfam ID: PF00534
• Sequence:
  MRLLFLAVLRPHTGNAVTAQRVRAHLEAAGHVCVLKDAFDFESRSEIANLILAENCEAAL
  ALHLYRGGRLLQGHRIPFGVIFGGTDVNEDANQAEKNTVMGRVLEEARFAVAFTESMKEM
  AQAQWPHAKGKVYVQSQGIATTPNAAFNWNTFLQRSEINQSADNLHIFLLICGLRQVKDP
  LYLVDAFSAWHQEEPNVHLVIVGPEVDPVFTREVKAKVKRAAGVRLIGEMPQEDLHAVVK
  NCFAVVNSSVSEGMSAAILEAMDLEVPVLARNIPGNAAVVKHEVTGLLFSNPQEFVHLAK
  RLVSDPALEKEIVVNGREYVRMYHSWQVERDTYQQLIRKLEGSTED

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Systemic lupus erythematosus	DISI1SZ7	Disputed	Genetic Variation	[1]
Asthma	DISW9QNS	Limited	Genetic Variation	[2]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[5]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[6]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[7]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[11]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Glycosyltransferase 1 domain-containing protein 1 (GLT1D1).	[10]

References

• [1] Publisher Correction: Genetic variants in systemic lupus erythematosus susceptibility loci, XKR6 and GLT1D1 are associated with childhood-onset SLE in a Korean cohort.Sci Rep. 2018 Jul 31;8(1):11713. doi: 10.1038/s41598-018-30082-9.
• [2] Genome-wide association study of leukotriene modifier response in asthma.Pharmacogenomics J. 2016 Apr;16(2):151-7. doi: 10.1038/tpj.2015.34. Epub 2015 Jun 2.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
• [8] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [11] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.