Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZT1PLE)

• DOT Name: Galactose-3-O-sulfotransferase 2 (GAL3ST2)
• Synonyms: Gal3ST-2; EC 2.8.2.-; Beta-galactose-3-O-sulfotransferase 2; Gal-beta-1, 3-GalNAc 3'-sulfotransferase 2; Glycoprotein beta-Gal 3'-sulfotransferase 2
• Gene Name: GAL3ST2
• Related Disease:
  Prostate cancer
  Prostate carcinoma
  Ankylosing spondylitis
  Crohn disease
  Psoriasis
  Sclerosing cholangitis
  Ulcerative colitis
• UniProt ID: G3ST2_HUMAN
• EC Number: 2.8.2.-
• Pfam ID: PF06990
• Sequence:
  MMSMLGGLQRYFRVILLLLLALTLLLLAGFLHSDLELDTPLFGGQAEGPPVTNIMFLKTH
  KTASSTVLNILYRFAETHNLSVALPAGSRVHLGYPWLFLARYVEGVGSQQRFNIMCNHLR
  FNLPQVQKVMPNDTFYFSILRNPVFQLESSFIYYKTYAPAFRGAPSLDAFLASPRTFYND
  SRHLRNVYAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLLRRR
  LRWALDDVVAFRLNSRSARSVARLSPETRERARSWCALDWRLYEHFNRTLWAQLRAELGP
  RRLRGEVERLRARRRELASLCLQDGGALKNHTQIRDPRLRPYQSGKADILGYNLRPGLDN
  QTLGVCQRLVMPELQYMARLYALQFPEKPLKNIPFLGA
• Function: Transfers a sulfate group to the hydroxyl group at C3 of non-reducing beta-galactosyl residues. Acts both on type 1 (Gal-beta-1,3-GlcNAc) and type 2 (Gal-beta-1,4-GlcNAc) chains with similar efficiency.
• Tissue Specificity: Ubiquitous. Detected in heart, stomach, colon, liver and spleen, in epithelial cells lining the lower to middle layer of the crypts in colonic mucosa, hepatocytes surrounding the central vein of the liver, extravillous cytotrophoblasts in the basal plate of the septum of the placenta, renal tubules of the kidney, and neuronal cells of the cerebral cortex.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Disputed	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Disputed	Biomarker	[1]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[2]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[2]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[2]
Sclerosing cholangitis	DIS7GZNB	Limited	Genetic Variation	[2]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[2]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Galactose-3-O-sulfotransferase 2 (GAL3ST2).	[3]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Galactose-3-O-sulfotransferase 2 (GAL3ST2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Galactose-3-O-sulfotransferase 2 (GAL3ST2).	[8]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Galactose-3-O-sulfotransferase 2 (GAL3ST2).	[4]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Galactose-3-O-sulfotransferase 2 (GAL3ST2).	[6]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Galactose-3-O-sulfotransferase 2 (GAL3ST2).	[7]

References

• [1] Recurrent cis-SAGe chimeric RNA, D2HGDH-GAL3ST2, in prostate cancer.Cancer Lett. 2016 Sep 28;380(1):39-46. doi: 10.1016/j.canlet.2016.06.013. Epub 2016 Jun 17.
• [2] Analysis of five chronic inflammatory diseases identifies 27 new associations and highlights disease-specific patterns at shared loci.Nat Genet. 2016 May;48(5):510-8. doi: 10.1038/ng.3528. Epub 2016 Mar 14.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [7] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.