Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT6L509)

• DTT Name: Coagulation factor IIa (F2)
• Synonyms: Prothrombin; Coagulation factor II
• Gene Name: F2
• DTT Type: Successful target; [1]
• BioChemical Class: Peptidase
• UniProt ID: THRB_HUMAN
• TTD ID: T94033
• EC Number: EC 3.4.21.5
• Sequence:
  MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
  VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
  NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
  CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
  QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
  DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
  DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
  DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
  VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
  RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
  GFYTHVFRLKKWIQKVIDQFGE
• Function: Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing.
• KEGG Pathway:
  Neuroactive ligand-receptor interaction (hsa04080)
  Complement and coagulation cascades (hsa04610)
  Regulation of actin cytoskeleton (hsa04810)
• Reactome Pathway:
  Common Pathway of Fibrin Clot Formation (R-HSA-140875)
  Gamma-carboxylation of protein precursors (R-HSA-159740)
  Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus (R-HSA-159763)
  Removal of aminoterminal propeptides from gamma-carboxylated proteins (R-HSA-159782)
  Cell surface interactions at the vascular wall (R-HSA-202733)
  Peptide ligand-binding receptors (R-HSA-375276)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  G alpha (q) signalling events (R-HSA-416476)
  Thrombin signalling through proteinase activated receptors (PARs) (R-HSA-456926)
  Intrinsic Pathway of Fibrin Clot Formation (R-HSA-140837)

Molecular Interaction Atlas (MIA) of This DTT

11 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Anisindione	DM2C48U	Coagulation defect	3B10.0	Approved	[2]
Argatroban	DMFI46A	Thrombosis	DB61-GB90	Approved	[3]
ATryn antithrombin	DM79Y2T	Multiple sclerosis	8A40	Approved	[4]
Bivalirudin	DMECRX1	Thrombocytopenia	3B64	Approved	[5]
Dabigatran	DMDI6R4	Stroke	8B20	Approved	[6]
Desirudin Recombinant	DM2BTFN	Coagulation defect	3B10.0	Approved	[7]
Human prothrombin complex concentrate	DMPHVQ1	Bleeding disorder	GA20-GA21	Approved	[8]
Lepirudin	DM1I3D5	Thrombocytopenia	3B64	Approved	[9]
Pyridoxal Phosphate	DMO2K0J	Malnutrition	5B50-5B71	Approved	[10]
Ximelegatran	DMU8ANS	Myocardial infarction	BA41-BA43	Approved	[1]
Hirudin	DMYOC29	N. A.	N. A.	Phase 4	[11]

16 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MELAGATRAN	DM4W8RE	N. A.	N. A.	Phase 3	[12]
SR-123781A	DM5WQ2U	Venous thrombosis	BA43	Phase 2/3	[13]
EFEGATRAN SULFATE HYDRATE	DMX4RSD	Myocardial infarction	BA41-BA43	Phase 2	[14]
EP-217609	DMPC4EK	Thrombosis	DB61-GB90	Phase 2	[15]
LB-30870	DM0OHX3	Myocardial infarction	BA41-BA43	Phase 2	[14]
NU-172	DMORNVB	Thrombosis	DB61-GB90	Phase 2	[16]
Odiparcil	DMWCBY7	Cardiovascular disease	BA00-BE2Z	Phase 2	[17]
Pegmusirudin	DMPD3X6	Angina pectoris	BA40	Phase 2	[8]
Recombinant RGD-hirudin	DMV0A28	Thrombosis	DB61-GB90	Phase 2	[18]
TF0023	DMF61ML	Heart attack	BA41	Phase 2	[19]
AZD-8165	DM8DMI0	Thrombosis	DB61-GB90	Phase 1	[8]
DP-4088	DMXZ6A0	Coagulation defect	3B10.0	Phase 1	[8]
EP-42675	DMKR3GD	Thrombosis	DB61-GB90	Phase 1	[20]
RWJ-671818	DMJVCS1	Thrombosis	DB61-GB90	Phase 1	[21]
Solulin	DMB3WJF	Thrombosis	DB61-GB90	Phase 1	[22]
SSR-128428	DMOJA7N	Thrombosis	DB61-GB90	Phase 1	[23]

29 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ximelagatran	DMABRJL	Coagulation defect	3B10.0	Withdrawn from market	[24]
AZD0837	DMA9Q2V	Nonvalvular atrial fibrillation	BC81.3Y	Discontinued in Phase 2	[25]
Dermolastin	DM6WSU2	Atopic dermatitis	EA80	Discontinued in Phase 2	[26]
INOGATRAN	DM6HDO3	Myocardial infarction	BA41-BA43	Discontinued in Phase 2	[27]
Napsagatran	DM8L4Z0	Myocardial infarction	BA41-BA43	Discontinued in Phase 2	[28]
SSR-182289	DMN7BM3	Myocardial infarction	BA41-BA43	Discontinued in Phase 2	[14]
Vasoflux	DMHCOFM	Myocardial infarction	BA41-BA43	Discontinued in Phase 2	[29]
ARC-183	DMKLCRI	Blood forming organ disorder	JB64.1	Discontinued in Phase 1	[30]
BCX-1470	DMN2XR7	Bleeding disorder	GA20-GA21	Discontinued in Phase 1	[31]
CJC-1004	DM3Q8UW	Thrombosis	DB61-GB90	Discontinued in Phase 1	[32]
CVS-1123	DMDRFZV	Myocardial infarction	BA41-BA43	Discontinued in Phase 1	[33]
GW-473178	DMRQVI9	Heart arrhythmia	BC65	Discontinued in Phase 1	[34]
Licostinel	DMMWCU3	Neurological disorder	6B60	Discontinued in Phase 1	[35]
MPC-0920	DMMVG34	Thrombosis	DB61-GB90	Discontinued in Phase 1	[36]
S-18326	DMX59E8	Myocardial infarction	BA41-BA43	Discontinued in Phase 1	[14]
UK-156406	DMGFPIY	Myocardial infarction	BA41-BA43	Discontinued in Phase 1	[14]
BCH-2763	DM3TP8X	Thrombosis	DB61-GB90	Terminated	[37]
BMS-189664	DMV3B5Y	Myocardial infarction	BA41-BA43	Terminated	[14]
CVS-995	DMMDO3X	Myocardial infarction	BA41-BA43	Terminated	[38]
DuP 714	DMZOCHT	Thrombosis	DB61-GB90	Terminated	[39]
Efegatran	DM7ROS1	N. A.	N. A.	Terminated	[39]
GS-522	DMT6S9B	Thrombosis	DB61-GB90	Terminated	[40]
Hementin	DM5HMZW	Thrombosis	DB61-GB90	Terminated	[41]
L-373890	DMOKZ2V	Thrombosis	DB61-GB90	Terminated	[42]
L-374,087	DMK2QW0	Thrombosis	DB61-GB90	Terminated	[43]
LB30057	DMYGJCL	N. A.	N. A.	Terminated	[44]
Org-34092	DM3VWZF	Thrombosis	DB61-GB90	Terminated	[8]
PPACK	DMLY2TN	N. A.	N. A.	Terminated	[39]
SR-80027A	DM6ASLF	Thrombosis	DB61-GB90	Terminated	[45]

86 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(3,4-dichlorophenyl)(1H-pyrazol-1-yl)methanone	DMNVDLI	Discovery agent	N.A.	Investigative	[46]
(3-nitro-1H-pyrazol-1-yl)(p-tolyl)methanone	DMT9FZD	Discovery agent	N.A.	Investigative	[46]
(3-nitro-1H-pyrazol-1-yl)(phenyl)methanone	DMD4Z6H	Discovery agent	N.A.	Investigative	[46]
(4-bromo-1H-pyrazol-1-yl)(p-tolyl)methanone	DM31OSD	Discovery agent	N.A.	Investigative	[46]
(4-nitro-1H-pyrazol-1-yl)(o-tolyl)methanone	DMBPL3J	Discovery agent	N.A.	Investigative	[46]
(4-nitro-1H-pyrazol-1-yl)(phenyl)methanone	DMIDUO9	Discovery agent	N.A.	Investigative	[46]
1,2,3,4,6-penta-O-galloyl-beta-D-glucose	DMTK650	Discovery agent	N.A.	Investigative	[47]
1-(HYDROXYMETHYLENEAMINO)-8-HYDROXY-OCTANE	DMBTLIJ	Discovery agent	N.A.	Investigative	[48]
1-benzoyl-N-phenyl-1H-pyrazole-3-carboxamide	DMG5MNZ	Discovery agent	N.A.	Investigative	[46]
2-(2-Hydroxy-phenyl)-1H-indole-5-carboxamidine	DM3UMYD	Discovery agent	N.A.	Investigative	[49]
2-NAPHTHALENESULFONIC ACID	DMZ4LJ7	Discovery agent	N.A.	Investigative	[48]
2-nas-phe(3-am)-4-(2-guanidinoethyl)piperidine	DMFXKN1	Discovery agent	N.A.	Investigative	[50]
3-chlorophenyl 2-oxo-2H-chromene-3-carboxylate	DMZ0F7E	Discovery agent	N.A.	Investigative	[51]
4-(2,5-DIAMINO-5-HYDROXY-PENTYL)-PHENOL	DM3D8OK	Discovery agent	N.A.	Investigative	[48]
4-(3,4-Diethoxy-benzylamino)-benzamidine	DMIZXYM	Discovery agent	N.A.	Investigative	[52]
4-(4-Benzyloxy-3-methoxy-benzylamino)-benzamidine	DME3PUT	Discovery agent	N.A.	Investigative	[52]
4-hydroxyphenylpyruvic acid	DM0564K	Discovery agent	N.A.	Investigative	[48]
4-iodobenzo[b]thiophene 2-carboxamidine	DMXAEGF	N. A.	N. A.	Investigative	[48]
4-TERT-BUTYLBENZENESULFONIC ACID	DMGCYS1	Discovery agent	N.A.	Investigative	[48]
4-[3-(4-CHLOROPHENYL)-1H-PYRAZOL-5-YL]PIPERIDINE	DMJI6AM	Discovery agent	N.A.	Investigative	[48]
5-desgalloylstachyurin	DM6TM1L	Discovery agent	N.A.	Investigative	[47]
6-(2-HYDROXY-CYCLOPENTYL)-7-OXO-HEPTANAMIDINE	DMA2CPG	Discovery agent	N.A.	Investigative	[48]
AC-(D)PHE-PRO-BOROHOMOLYS-OH	DMZ0RP5	Discovery agent	N.A.	Investigative	[48]
AC-(D)PHE-PRO-BOROHOMOORNITHINE-OH	DMPHV7K	Discovery agent	N.A.	Investigative	[48]
AC-(D)PHE-PRO-BOROLYS-OH	DM2YWRL	Discovery agent	N.A.	Investigative	[48]
Bbs-Arg-(D-Pip)-Gly-(EQKLISEEDL)-Gly-Hir	DMMJ4I5	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-(SPH(pY)EKVS)-Gly-Hir	DM8TH4B	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-(SPHYEKVS)-Gly-Hir	DMQVRHG	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-S-(GS)1-Gly-Hir	DMTU0HR	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-S-(GS)11-Gly-Hir	DMXECFJ	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-S-(GS)13-Gly-Hir	DM5N6YE	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-S-(GS)3-Gly-Hir	DMEL2GK	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-S-(GS)5-Gly-Hir	DMCN48J	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-S-(GS)7-Gly-Hir	DMLK5I0	Discovery agent	N.A.	Investigative	[53]
Bbs-Arg-(D-Pip)-Gly-S-(GS)9-Gly-Hir	DMLZ5R6	Discovery agent	N.A.	Investigative	[53]
BENZOTHIAZOLE	DMV7MPL	Discovery agent	N.A.	Investigative	[48]
Beta-(2-Naphthyl)-Alanine	DMP21ZO	Discovery agent	N.A.	Investigative	[48]
Beta-phenyl-D-phenylalanyl-N-propyl-L-prolinamide	DMQXMKB	Discovery agent	N.A.	Investigative	[48]
BMS-344577	DM9WRUG	Discovery agent	N.A.	Investigative	[54]
BMS-740808	DMQ24TI	Discovery agent	N.A.	Investigative	[55]
bufrudin	DMWQ3RH	Discovery agent	N.A.	Investigative	[56]
CASUARIIN	DM5E21C	Discovery agent	N.A.	Investigative	[47]
CHLORODYSINOSIN A	DMGS3FI	Discovery agent	N.A.	Investigative	[57]
COCHINCHINENENE B	DMCSAIJ	Discovery agent	N.A.	Investigative	[58]
COCHINCHINENIN B	DMIGB7N	Discovery agent	N.A.	Investigative	[58]
CRA_8696	DM3IZOP	Discovery agent	N.A.	Investigative	[48]
CVS-1578	DMO9UMK	Discovery agent	N.A.	Investigative	[59]
Cyclotheonamide E	DM8HG0K	Discovery agent	N.A.	Investigative	[60]
Cyclotheonamide E4	DM2E5VZ	Discovery agent	N.A.	Investigative	[60]
Cyclotheonamide E5	DMCA76M	Discovery agent	N.A.	Investigative	[60]
D-leucyl-N-(3-chlorobenzyl)-L-prolinamide	DMVN93B	Discovery agent	N.A.	Investigative	[48]
D-leucyl-N-(4-carbamimidoylbenzyl)-L-prolinamide	DMIFCHL	Discovery agent	N.A.	Investigative	[48]
D-phenylalanyl-N-(3-chlorobenzyl)-L-prolinamide	DMGD7JM	Discovery agent	N.A.	Investigative	[48]
D-phenylalanyl-N-(3-fluorobenzyl)-L-prolinamide	DM5XHA6	Discovery agent	N.A.	Investigative	[48]
D-phenylalanyl-N-(3-methylbenzyl)-L-prolinamide	DMV9RAN	Discovery agent	N.A.	Investigative	[48]
D-phenylalanyl-N-benzyl-L-prolinamide	DMHNR63	Discovery agent	N.A.	Investigative	[48]
D-Pro-Phe-Arg chloromethyl ketone	DMRJQ8X	Discovery agent	N.A.	Investigative	[61]
Desirudine	DMB07WE	Discovery agent	N.A.	Investigative	[10]
DYSINOSIN A	DMU42C1	Discovery agent	N.A.	Investigative	[57]
Enoxaprin	DMYJ8ZB	Discovery agent	N.A.	Investigative	[62]
Gamma-Carboxy-Glutamic Acid	DMZMCT0	Discovery agent	N.A.	Investigative	[63]
GR-133686	DMQH8PK	Discovery agent	N.A.	Investigative	[64]
Haempatch	DMO6MGJ	Bleeding disorder	GA20-GA21	Investigative	[8]
Hemi-Babim	DMXP276	Discovery agent	N.A.	Investigative	[48]
Heparin-Cantithrombin III	DM7U491	Discovery agent	N.A.	Investigative	[65]
L-370,518	DMC1Z0L	Discovery agent	N.A.	Investigative	[66]
L-375378	DMQWKPM	Discovery agent	N.A.	Investigative	[67]
LB30812	DM3H9ZY	Discovery agent	N.A.	Investigative	[68]
Lysophosphotidylserine	DMIG3FX	Discovery agent	N.A.	Investigative	[63]
Macrocyclic tripeptide motif	DMFULZO	Discovery agent	N.A.	Investigative	[69]
Melogatran	DME54M7	Discovery agent	N.A.	Investigative	[65]
Methyl L-phenylalaninate	DMBHUKV	Discovery agent	N.A.	Investigative	[48]
METHYL-PHE-PRO-AMINO-CYCLOHEXYLGLYCINE	DMR7HV3	Discovery agent	N.A.	Investigative	[48]
N4-(N,N-diphenylcarbamoyl)-aminoguanidine	DMYPZMO	Discovery agent	N.A.	Investigative	[48]
OSCILLARIN	DMK6X5P	Discovery agent	N.A.	Investigative	[57]
Pedunculagin	DMKLRCX	Discovery agent	N.A.	Investigative	[47]
RAZAXABAN	DMPML15	Discovery agent	N.A.	Investigative	[70]
RWJ-50353	DMRPYGX	Discovery agent	N.A.	Investigative	[71]
S-2238	DM3GS2X	Discovery agent	N.A.	Investigative	[72]
SC-79407	DMD71VB	Discovery agent	N.A.	Investigative	[43]
TB-101	DMCZIFS	Bleeding disorder	GA20-GA21	Investigative	[8]
TB-102	DMUN8CG	Bleeding disorder	GA20-GA21	Investigative	[8]
Tellimagrandin II	DM60HU5	Discovery agent	N.A.	Investigative	[47]
Tumor vascular thrombogen	DMIRQ65	Solid tumour/cancer	2A00-2F9Z	Investigative	[8]
VE-04051645	DM3GADP	Solid tumour/cancer	2A00-2F9Z	Investigative	[8]
Vitamin K	DMN6EZY	Discovery agent	N.A.	Investigative	[73]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Thrombocytopenia	3B64	Whole blood	7.64E-01	0.2	0.77
Atopic dermatitis	EA90	Skin	7.71E-01	0.02	0.22

References

• [1] Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90.
• [2] Anticoagulation with anisindione in a patient with a warfarin-induced skin eruption. Pharmacotherapy. 2003 Apr;23(4):533-6.
• [3] Studies on the different modes of action of the anticoagulant protease inhibitors DX-9065a and Argatroban. I. Effects on thrombin generation. J Biol Chem. 2002 Dec 27;277(52):50439-44.
• [4] Antithrombin III Utilization in a Large Teaching Hospital. P T. 2013 December; 38(12): 764-767, 779.
• [5] New anticoagulants. Am Heart J. 2001 Aug;142(2 Suppl):S3-8.
• [6] Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
• [7] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [8] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2362).
• [9] Recombinant hirudin (lepirudin) as anticoagulant in intensive care patients treated with continuous hemodialysis. Kidney Int Suppl. 1999 Nov;(72):S46-50.
• [10] New antithrombotic drugs (excluding plasminogen activators. Arch Mal Coeur Vaiss. 2001 Nov;94(11 Suppl):1225-32.
• [11] Probing the hirudin-thrombin interaction by incorporation of noncoded amino acids and molecular dynamics simulation. Biochemistry. 2002 Nov 19;41(46):13556-69.
• [12] Orally active thrombin inhibitors. Part 2: optimization of the P2-moiety. Bioorg Med Chem Lett. 2006 May 15;16(10):2648-53.
• [13] SR123781A, a synthetic heparin mimetic. Thromb Haemost. 2001 May;85(5):852-60.
• [14] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [15] Specificity and selectivity profile of EP217609: a new neutralizable dual-action anticoagulant that targets thrombin and factor Xa.Blood.2012 Mar 8;119(10):2187-95.
• [16] Nucleic acid aptamers: clinical applications and promising new horizons. Curr Med Chem. 2011; 18(27): 4206-4214.
• [17] A comparison of the beta-D-xyloside, odiparcil, to warfarin in a rat model of venous thrombosis. J Thromb Haemost. 2006 Sep;4(9):1989-96.
• [18] The NMR solution structure of recombinant RGD-hirudin. Biochem Biophys Res Commun. 2007 Aug 17;360(1):103-8.
• [19] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [20] EP42675, a synthetic parenteral dual-action anticoagulant: pharmacokinetics, pharmacodynamics, and absence of interactions with antiplatelet drugs. J Thromb Haemost. 2014 Jan;12(1):24-33.
• [21] Discovery and clinical evaluation of 1-{N-[2-(amidinoaminooxy)ethyl]amino}carbonylmethyl-6-methyl-3-[2,2-difluoro-2-phenylethylamino]pyrazinone (RW... J Med Chem. 2010 Feb 25;53(4):1843-56.
• [22] The thrombomodulin analog Solulin promotes reperfusion and reduces infarct volume in a thrombotic stroke model. J Thromb Haemost. 2011 Jun;9(6):1174-82.
• [23] Company report (Sanofi) (drug: FY2008)
• [24] Ximelagatran increases membrane fluidity and changes membrane lipid composition in primary human hepatocytes. Toxicol In Vitro. 2009 Oct;23(7):1305-10.
• [25] Clinical pipeline report, company report or official report of AstraZeneca (2009).
• [26] Arriva-ProMetic recombinant alpha 1-antitrypsin (rAAT) moves into the clinic for dermatology applications. ProMetic Life Sciences. 2009.
• [27] Inogatran, a novel direct low molecular weight thrombin inhibitor, given with, but not after, tissue-plasminogen activator, improves thrombolysis. J Pharmacol Exp Ther. 1996 Jun;277(3):1276-83.
• [28] Effects of napsagatran (Ro 46-6240), a new synthetic thrombin inhibitor and of heparin in a canine model of coronary artery thrombosis: comparison with an ex vivo annular perfusion chamber model. J Pharmacol Exp Ther. 1996 Apr;277(1):71-8.
• [29] Vasoflux, a new anticoagulant with a novel mechanism of action. Circulation. 1999 Feb 9;99(5):682-9.
• [30] A high affinity, antidote-controllable prothrombin and thrombin-binding RNA aptamer inhibits thrombin generation and thrombin activity. J Thromb Haemost. 2012 May;10(5):870-80.
• [31] Recent Developments in Low Molecular Weight Complement Inhibitors. Mol Immunol. 2009 December; 47(2-3): 185-195.
• [32] Gateways to clinical trials. Methods Find Exp Clin Pharmacol. 2003 Jun;25(5):387-408.
• [33] CVS-1123, a direct thrombin inhibitor, prevents occlusive arterial and venous thrombosis in a canine model of vascular injury. J Cardiovasc Pharmacol. 1997 Feb;29(2):240-9.
• [34] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015039)
• [35] Neuroprotective agents for the treatment of acute ischemic stroke. Curr Neurol Neurosci Rep. 2003 Jan;3(1):9-20.
• [36] Clinical pipeline report, company report or official report of MYRIAD GENETICS, INC.
• [37] BCH-2763, a novel potent parenteral thrombin inhibitor, is an effective antithrombotic agent in rodent models of arterial and venous thrombosis--comparisons with heparin, r-hirudin, hirulog, inogatran and argatroban. Thromb Haemost. 1998 Feb;79(2):431-8.
• [38] Synthesis, structure, and structure-activity relationships of divalent thrombin inhibitors containing an alpha-keto-amide transition-state mimetic. Protein Sci. 1996 Mar;5(3):422-33.
• [39] Anticoagulation: the present and future. Clin Appl Thromb Hemost. 2001 Jul;7(3):195-204.
• [40] A novel oligodeoxynucleotide inhibitor of thrombin. I. In vitro metabolic stability in plasma and serum. Pharm Res. 1995 Dec;12(12):1937-42.
• [41] Hementin: anticoagulant protease from the salivary gland of the leech Haementeria ghilianii. J Lab Clin Med. 1984 Jan;103(1):44-58.
• [42] L-374,087, an efficacious, orally bioavailable, pyridinone acetamide thrombin inhibitor. Bioorg Med Chem Lett. 1998 Apr 7;8(7):817-22.
• [43] Pharmacological intervention at disparate sites in the coagulation cascade: comparison of anti-thrombotic efficacy vs bleeding propensity in a rat model of acute arterial thrombosis. J Thromb Thrombolysis. 2002 Oct;14(2):113-21.
• [44] Antithrombotic activity of LB30057, a newly synthesized direct thrombin inhibitor. Thromb Haemost. 2003 Jan;89(1):104-11.
• [45] Pharmacokinetic and antithrombotic properties of two pentasaccharides with high affinity to antithrombin III in the rabbit: comparison with CY216. Blood. 1994 Oct 15;84(8):2571-7.
• [46] N-benzoylpyrazoles are novel small-molecule inhibitors of human neutrophil elastase. J Med Chem. 2007 Oct 4;50(20):4928-38.
• [47] Effects of tannins from Geum japonicum on the catalytic activity of thrombin and factor Xa of blood coagulation cascade. J Nat Prod. 1998 Nov;61(11):1356-60.
• [48] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [49] Development of serine protease inhibitors displaying a multicentered short (<2.3 A) hydrogen bond binding mode: inhibitors of urokinase-type plasmi... J Med Chem. 2001 Aug 16;44(17):2753-71.
• [50] Secondary amides of sulfonylated 3-amidinophenylalanine. New potent and selective inhibitors of matriptase. J Med Chem. 2006 Jul 13;49(14):4116-26.
• [51] 3,6-disubstituted coumarins as mechanism-based inhibitors of thrombin and factor Xa. J Med Chem. 2005 Dec 1;48(24):7592-603.
• [52] Design of selective phenylglycine amide tissue factor/factor VIIa inhibitors. Bioorg Med Chem Lett. 2005 Feb 1;15(3):817-22.
• [53] Transforming bivalent ligands into retractable enzyme inhibitors through polypeptide-protein interactions. Bioorg Med Chem Lett. 2005 Dec 1;15(23):5120-3.
• [54] Aroylguanidine-based factor Xa inhibitors: the discovery of BMS-344577. Bioorg Med Chem Lett. 2009 Dec 15;19(24):6882-9.
• [55] Structure-activity relationship and pharmacokinetic profile of 5-ketopyrazole factor Xa inhibitors. Bioorg Med Chem Lett. 2008 Jan 15;18(2):749-54.
• [56] Leech therapeutic applications.Indian J Pharm Sci.2013 Mar;75(2):127-37.
• [57] From natural products to achiral drug prototypes: potent thrombin inhibitors based on P2/P3 dihydropyrid-2-one core motifs. Bioorg Med Chem Lett. 2009 Sep 15;19(18):5429-32.
• [58] Anti-Helicobacter pylori and thrombin inhibitory components from Chinese dragon's blood, Dracaena cochinchinensis. J Nat Prod. 2007 Oct;70(10):1570-7.
• [59] Design and construction of novel thrombin inhibitors featuring P3-P4 quaternary lactam dipeptide surrogates. Bioorg Med Chem Lett. 1998 Sep 22;8(18):2501-6.
• [60] Cyclotheonamide E4 and E5, new potent tryptase inhibitors from an Ircinia species of sponge. J Nat Prod. 2002 Mar;65(3):259-61.
• [61] Novel 3-carboxamide-coumarins as potent and selective FXIIa inhibitors. J Med Chem. 2008 Jun 12;51(11):3077-80.
• [62] Low molecular weight heparins and their use in obstetrics and gynecology. Obstet Gynecol Surv. 1994 Jun;49(6):424-31.
• [63] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [64] 5,5-trans lactone-containing inhibitors of serine proteases: identification of a novel, acylating thrombin inhibitor. Bioorg Med Chem Lett. 1998 Nov 3;8(21):2955-60.
• [65] Thrombin inhibitors in acute coronary artery disease. Eur Heart J. 2002 Aug;23(15):1142-4.
• [66] Assessment of thrombin inhibitor efficacy in a novel rabbit model of simultaneous arterial and venous thrombosis. Thromb Haemost. 1998 Mar;79(3):656-62.
• [67] Small, low nanomolar, noncovalent thrombin inhibitors lacking a group to fill the 'distal binding pocket'. Bioorg Med Chem Lett. 2003 Jan 20;13(2):161-4.
• [68] Efficacious and orally bioavailable thrombin inhibitors based on a 2,5-thienylamidine at the P1 position: discovery of N-carboxymethyl-d-diphenylalanyl-l-prolyl[(5-amidino-2-thienyl)methyl]amide. J Med Chem. 2003 Aug 14;46(17):3612-22.
• [69] Novel thrombin inhibitors that are based on a macrocyclic tripeptide motif, Bioorg. Med. Chem. Lett. 6(24):2947-2952 (1996).
• [70] Phenyltriazolinones as potent factor Xa inhibitors. Bioorg Med Chem Lett. 2010 Feb 15;20(4):1373-7.
• [71] Inhibitors of proteases and amide hydrolases that employ an alpha-ketoheterocycle as a key enabling functionality. Bioorg Med Chem. 2008 Feb 15;16(4):1562-95.
• [72] Screening for selective thrombin inhibitors in mushrooms. Blood Coagul Fibrinolysis. 2001 Mar;12(2):123-8.
• [73] Plasma levels of protein C and vitamin K-dependent coagulation factors in patients on long-term oral anticoagulant therapy. Tohoku J Exp Med. 1986 Aug;149(4):351-7.