Details of the Drug

General Information of Drug (ID: DM1I3D5)

Drug Name

Lepirudin

Synonyms

Refludan; Refludin; Aventis Behring Brand of Lepirudin; Aventis Brand Lepirudin; Aventis Pharma Brand of Lepirudin; Berlex Brand of Lepirudin; Hoechst Brand of Lepirudin; Lepirudin recombinant; Pharmion Brand of Lepirudin; Schering Brand of Lepirudin; Hbw 023; Hbw-023; 1-L-Leucine-2-L-threonine-63-desulfohirudin (Hirudomedicinalis isoform HV1); 1-Leu-2-thr-63-desulfohirudin

Indication

Disease Entry	ICD 11	Status	REF
Thrombocytopenia	3B64	Approved	[1]
------------------------------------------------------------------------------------

Therapeutic Class

Antithrombotic Agents

Drug Type

Small molecular drug

Sequence

LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIP
EEYLQ

Structure

3D MOL is unavailable

2D MOL

#Ro5 Violations (Lipinski): 5

Molecular Weight (mw)

6979

Logarithm of the Partition Coefficient (xlogp)

-41.3

Rotatable Bond Count (rotbonds)

166

Hydrogen Bond Donor Count (hbonddonor)

100

Hydrogen Bond Acceptor Count (hbondacc)

122

ADMET Property

Bioavailability: The bioavailability of drug is 100% []
Half-life: The concentration or amount of drug in body reduced by one-half in 1.3 hours [2]
Metabolism: The drug is metabolized via release of amino acids via catabolic hydrolysis of the parent drug []
Vd: The volume of distribution (Vd) of drug is 12.2 L []

Chemical Identifiers

Formula: C287H440N80O111S6
IUPAC Name: (2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2S,3R)-2-[[2-[[(2S)-2-[[2-[[(2S,3R)-2-[[(2S)-2-[[(1R,6R,9S,12S,15S,18S,24S,27S,33S,36S,39R,44R,47S,53S,56S,59S,67S,73S,76S)-15,76-bis(4-aminobutyl)-44-[[(2S)-2-[[(4R,7S,10S,13S,19S,22S,25S,28R)-28-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-amino-4-methylpentanoyl]amino]-3-hydroxybutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxybutanoyl]amino]-3-carboxypropanoyl]amino]-10-(2-amino-2-oxoethyl)-13-(3-amino-3-oxopropyl)-22-(2-carboxyethyl)-25-[(1R)-1-hydroxyethyl]-19-(hydroxymethyl)-7-(2-methylpropyl)-6,9,12,15,18,21,24,27-octaoxo-1,2-dithia-5,8,11,14,17,20,23,26-octazacyclononacosane-4-carbonyl]amino]-4-methylpentanoyl]amino]-12,56,73-tris(2-amino-2-oxoethyl)-9,67-bis(3-amino-3-oxopropyl)-36-[(2S)-butan-2-yl]-18,47-bis(2-carboxyethyl)-24-(carboxymethyl)-27,53-bis(hydroxymethyl)-33-(2-methylpropyl)-8,11,14,17,20,23,26,29,32,35,38,45,48,51,54,57,60,62,65,68,71,74,77-tricosaoxo-59-propan-2-yl-3,4,41,42-tetrathia-7,10,13,16,19,22,25,28,31,34,37,46,49,52,55,58,61,63,66,69,72,75,78-tricosazabicyclo[37.22.17]octaheptacontane-6-carbonyl]amino]-3-methylbutanoyl]amino]-3-hydroxybutanoyl]amino]acetyl]amino]-4-carboxybutanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-4-oxobutanoyl]amino]-3-carboxypropanoyl]amino]acetyl]amino]-3-carboxypropanoyl]amino]-3-phenylpropanoyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-3-methylpentanoyl]pyrrolidine-2-carbonyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoic acid
Canonical SMILES: CC[C@H](C)[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CSSC[C@H]2C(=O)NCC(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N2)C(C)C)CC(=O)N)CO)CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]3CSSC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N3)CC(C)C)CC(=O)N)CCC(=O)N)CO)CCC(=O)O)[C@@H](C)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)N)C(=O)N1)CCCCN)CC(=O)N)CCC(=O)N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N5CCC[C@H]5C(=O)N[C@@H](CCCCN)C(=O)N6CCC[C@H]6C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC7=CNC=N7)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC8=CC=CC=C8)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N9CCC[C@H]9C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)O)CCC(=O)N)CC(=O)N)CCCCN)CCC(=O)O)CC(=O)O)CO)CC(C)C
InChI: InChI=1S/C287H440N80O111S6/c1-24-132(17)225-280(470)345-162(87-126(5)6)236(426)306-111-209(396)320-181(116-370)267(457)344-176(101-220(416)417)238(428)307-105-203(390)316-152(61-74-213(402)403)243(433)321-146(40-29-32-80-288)241(431)339-171(96-198(298)385)259(449)326-153(56-69-194(294)381)250(440)351-186(121-482-479-118-183-240(430)310-107-202(389)313-148(54-67-192(292)379)233(423)303-108-206(393)317-170(95-197(297)384)258(448)322-147(41-30-33-81-289)242(432)350-187(272(462)359-225)122-483-480-119-184(269(459)323-150(60-73-212(400)401)235(425)304-110-208(395)319-180(115-369)266(456)342-174(99-201(301)388)265(455)357-223(130(13)14)278(468)355-183)352-254(444)165(90-129(11)12)335-270(460)185-120-481-484-123-188(354-263(453)178(103-222(420)421)347-283(473)230(137(22)375)362-264(454)168(93-141-48-52-144(378)53-49-141)346-282(472)228(135(20)373)361-232(422)145(291)86-125(3)4)273(463)363-229(136(21)374)281(471)330-158(65-78-217(410)411)249(439)348-179(114-368)239(429)309-106-204(391)315-151(55-68-193(293)380)244(434)340-172(97-199(299)386)260(450)334-164(89-128(9)10)253(443)353-185)271(461)358-224(131(15)16)279(469)364-227(134(19)372)277(467)311-112-205(392)314-149(59-72-211(398)399)234(424)305-113-210(397)356-231(138(23)376)286(476)367-85-37-45-191(367)276(466)331-160(42-31-34-82-290)284(474)365-83-35-43-189(365)274(464)328-154(57-70-195(295)382)248(438)349-182(117-371)268(458)338-169(94-142-104-302-124-312-142)257(447)341-173(98-200(300)387)261(451)343-175(100-219(414)415)237(427)308-109-207(394)318-177(102-221(418)419)262(452)337-166(91-139-38-27-26-28-39-139)255(445)327-155(62-75-214(404)405)245(435)325-159(66-79-218(412)413)251(441)360-226(133(18)25-2)285(475)366-84-36-44-190(366)275(465)329-157(64-77-216(408)409)246(436)324-156(63-76-215(406)407)247(437)336-167(92-140-46-50-143(377)51-47-140)256(446)333-163(88-127(7)8)252(442)332-161(287(477)478)58-71-196(296)383/h26-28,38-39,46-53,104,124-138,145-191,223-231,368-378H,24-25,29-37,40-45,54-103,105-123,288-291H2,1-23H3,(H2,292,379)(H2,293,380)(H2,294,381)(H2,295,382)(H2,296,383)(H2,297,384)(H2,298,385)(H2,299,386)(H2,300,387)(H2,301,388)(H,302,312)(H,303,423)(H,304,425)(H,305,424)(H,306,426)(H,307,428)(H,308,427)(H,309,429)(H,310,430)(H,311,467)(H,313,389)(H,314,392)(H,315,391)(H,316,390)(H,317,393)(H,318,394)(H,319,395)(H,320,396)(H,321,433)(H,322,448)(H,323,459)(H,324,436)(H,325,435)(H,326,449)(H,327,445)(H,328,464)(H,329,465)(H,330,471)(H,331,466)(H,332,442)(H,333,446)(H,334,450)(H,335,460)(H,336,437)(H,337,452)(H,338,458)(H,339,431)(H,340,434)(H,341,447)(H,342,456)(H,343,451)(H,344,457)(H,345,470)(H,346,472)(H,347,473)(H,348,439)(H,349,438)(H,350,432)(H,351,440)(H,352,444)(H,353,443)(H,354,453)(H,355,468)(H,356,397)(H,357,455)(H,358,461)(H,359,462)(H,360,441)(H,361,422)(H,362,454)(H,363,463)(H,364,469)(H,398,399)(H,400,401)(H,402,403)(H,404,405)(H,406,407)(H,408,409)(H,410,411)(H,412,413)(H,414,415)(H,416,417)(H,418,419)(H,420,421)(H,477,478)/t132-,133-,134+,135+,136+,137+,138+,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,166-,167-,168-,169-,170-,171-,172-,173-,174-,175-,176-,177-,178-,179-,180-,181-,182-,183-,184-,185-,186-,187-,188-,189-,190-,191-,223-,224-,225-,226-,227-,228-,229-,230-,231-/m0/s1
InChIKey: FIBJDTSHOUXTKV-BRHMIFOHSA-N

Cross-matching ID

PubChem CID: 118856773
ChEBI ID: CHEBI:142437
CAS Number: 138068-37-8
DrugBank ID: DB00001
TTD ID: D09LPN

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Coagulation factor IIa (F2)	TT6L509	THRB_HUMAN	Inhibitor	[3]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Lepirudin

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Bivalirudin	DMECRX1	Major	Increased risk of bleeding by the combination of Lepirudin and Bivalirudin.	Thrombocytopenia [3B64]	[4]
Caplacizumab	DMPUKA7	Major	Increased risk of bleeding by the combination of Lepirudin and Caplacizumab.	Thrombocytopenia [3B64]	[5]
-----------

Coadministration of a Drug Treating the Disease Different from Lepirudin (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Abciximab	DMJO6GV	Major	Increased risk of bleeding by the combination of Lepirudin and Abciximab.	Angina pectoris [BA40]	[6]
Eptifibatide	DMQXTJS	Major	Increased risk of bleeding by the combination of Lepirudin and Eptifibatide.	Angina pectoris [BA40]	[6]
Cilostazol	DMZMSCT	Major	Increased risk of bleeding by the combination of Lepirudin and Cilostazol.	Arterial occlusive disease [BD40]	[6]
Vitamin E	DMZC90K	Moderate	Increased risk of bleeding by the combination of Lepirudin and Vitamin E.	Cardiovascular disease [BA00-BE2Z]	[7]
Drotrecogin alfa	DM59JCN	Major	Increased risk of bleeding by the combination of Lepirudin and Drotrecogin alfa.	Cerebral ischaemia [8B1Z]	[8]
Pentosan polysulfate	DM2HRKE	Moderate	Increased risk of bleeding by the combination of Lepirudin and Pentosan polysulfate.	Chronic pain [MG30]	[9]
Phenylbutazone	DMAYL0T	Moderate	Increased risk of bleeding by the combination of Lepirudin and Phenylbutazone.	Chronic pain [MG30]	[6]
Ketoprofen	DMRKXPT	Moderate	Increased risk of bleeding by the combination of Lepirudin and Ketoprofen.	Chronic pain [MG30]	[6]
Levomilnacipran	DMV26S8	Moderate	Increased risk of bleeding by the combination of Lepirudin and Levomilnacipran.	Chronic pain [MG30]	[10]
Anisindione	DM2C48U	Major	Increased risk of bleeding by the combination of Lepirudin and Anisindione.	Coagulation defect [3B10]	[11]
Regorafenib	DMHSY1I	Major	Increased risk of bleeding by the combination of Lepirudin and Regorafenib.	Colorectal cancer [2B91]	[12]
Intedanib	DMSTA36	Moderate	Increased risk of bleeding by the combination of Lepirudin and Intedanib.	Colorectal cancer [2B91]	[13]
Ardeparin	DMYRX8B	Major	Increased risk of bleeding by the combination of Lepirudin and Ardeparin.	Coronary thrombosis [BA43]	[14]
Danaparoid	DM6CLBN	Major	Increased risk of bleeding by the combination of Lepirudin and Danaparoid.	Deep vein thrombosis [BD71]	[14]
Rivaroxaban	DMQMBZ1	Major	Increased risk of bleeding by the combination of Lepirudin and Rivaroxaban.	Deep vein thrombosis [BD71]	[15]
Sertraline	DM0FB1J	Moderate	Increased risk of bleeding by the combination of Lepirudin and Sertraline.	Depression [6A70-6A7Z]	[10]
Fluoxetine	DM3PD2C	Moderate	Increased risk of bleeding by the combination of Lepirudin and Fluoxetine.	Depression [6A70-6A7Z]	[10]
Vilazodone	DM4LECQ	Moderate	Increased risk of bleeding by the combination of Lepirudin and Vilazodone.	Depression [6A70-6A7Z]	[10]
Paroxetine	DM5PVQE	Moderate	Increased risk of bleeding by the combination of Lepirudin and Paroxetine.	Depression [6A70-6A7Z]	[10]
Vortioxetine	DM6F1PU	Moderate	Increased risk of bleeding by the combination of Lepirudin and Vortioxetine.	Depression [6A70-6A7Z]	[10]
Duloxetine	DM9BI7M	Moderate	Increased risk of bleeding by the combination of Lepirudin and Duloxetine.	Depression [6A70-6A7Z]	[10]
Milnacipran	DMBFE74	Moderate	Increased risk of bleeding by the combination of Lepirudin and Milnacipran.	Depression [6A70-6A7Z]	[10]
Escitalopram	DMFK9HG	Moderate	Increased risk of bleeding by the combination of Lepirudin and Escitalopram.	Depression [6A70-6A7Z]	[10]
Desvenlafaxine	DMHD4PE	Moderate	Increased risk of bleeding by the combination of Lepirudin and Desvenlafaxine.	Depression [6A70-6A7Z]	[10]
Clomipramine	DMINRKW	Moderate	Increased risk of bleeding by the combination of Lepirudin and Clomipramine.	Depression [6A70-6A7Z]	[10]
Fluvoxamine	DMQTJSX	Moderate	Increased risk of bleeding by the combination of Lepirudin and Fluvoxamine.	Depression [6A70-6A7Z]	[10]
Venlafaxine	DMR6QH0	Moderate	Increased risk of bleeding by the combination of Lepirudin and Venlafaxine.	Depression [6A70-6A7Z]	[10]
Heme	DMGC287	Moderate	Increased risk of bleeding by the combination of Lepirudin and Heme.	Discovery agent [N.A.]	[16]
Apigenin	DMI3491	Minor	Increased risk of bleeding by the combination of Lepirudin and Apigenin.	Discovery agent [N.A.]	[17]
Citalopram derivative 1	DMITX1G	Moderate	Increased risk of bleeding by the combination of Lepirudin and Citalopram derivative 1.	Discovery agent [N.A.]	[10]
PMID28870136-Compound-49	DMTUC9E	Moderate	Increased risk of bleeding by the combination of Lepirudin and PMID28870136-Compound-49.	Discovery agent [N.A.]	[18]
Fenfluramine	DM0762O	Moderate	Increased risk of bleeding by the combination of Lepirudin and Fenfluramine.	Epilepsy/seizure [8A61-8A6Z]	[10]
Suprofen	DMKXJZ7	Moderate	Increased risk of bleeding by the combination of Lepirudin and Suprofen.	Eye anterior segment structural developmental anomaly [LA11]	[19]
Mefenamic acid	DMK7HFI	Moderate	Increased risk of bleeding by the combination of Lepirudin and Mefenamic acid.	Female pelvic pain [GA34]	[6]
Avapritinib	DMK2GZX	Major	Increased risk of bleeding by the combination of Lepirudin and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[12]
Sulfinpyrazone	DMEV954	Major	Increased risk of bleeding by the combination of Lepirudin and Sulfinpyrazone.	Gout [FA25]	[6]
Tipranavir	DM8HJX6	Major	Increased risk of bleeding by the combination of Lepirudin and Tipranavir.	Human immunodeficiency virus disease [1C60-1C62]	[20]
Dipyridamole	DMXY30O	Major	Increased risk of bleeding by the combination of Lepirudin and Dipyridamole.	Hypertension [BA00-BA04]	[6]
Meclofenamic acid	DM05FXR	Moderate	Increased risk of bleeding by the combination of Lepirudin and Meclofenamic acid.	Inflammatory spondyloarthritis [FA92]	[6]
Ticlopidine	DMO946V	Major	Increased risk of bleeding by the combination of Lepirudin and Ticlopidine.	Ischaemic/haemorrhagic stroke [8B20]	[6]
Tositumomab	DMMYZ3D	Major	Increased risk of bleeding by the combination of Lepirudin and Tositumomab.	Malignant haematopoietic neoplasm [2B33]	[21]
Alemtuzumab	DMZL3IV	Moderate	Increased risk of bleeding by the combination of Lepirudin and Alemtuzumab.	Mature B-cell leukaemia [2A82]	[5]
Acalabrutinib	DM7GCVW	Major	Increased risk of bleeding by the combination of Lepirudin and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[22]
Ibrutinib	DMHZCPO	Major	Increased risk of bleeding by the combination of Lepirudin and Ibrutinib.	Mature B-cell lymphoma [2A85]	[23]
Ponatinib	DMYGJQO	Major	Increased risk of bleeding by the combination of Lepirudin and Ponatinib.	Mature B-cell lymphoma [2A85]	[24]
Panobinostat	DM58WKG	Major	Increased risk of bleeding by the combination of Lepirudin and Panobinostat.	Multiple myeloma [2A83]	[5]
Fedratinib	DM4ZBK6	Major	Increased risk of bleeding by the combination of Lepirudin and Fedratinib.	Myeloproliferative neoplasm [2A20]	[6]
Dasatinib	DMJV2EK	Major	Increased risk of bleeding by the combination of Lepirudin and Dasatinib.	Myeloproliferative neoplasm [2A20]	[25]
Omacetaxine mepesuccinate	DMPU2WX	Major	Increased risk of bleeding by the combination of Lepirudin and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[9]
Urokinase	DM0GOUD	Major	Increased risk of bleeding by the combination of Lepirudin and Urokinase.	Myocardial infarction [BA41-BA43]	[26]
Anistreplase	DM6Q4B0	Major	Increased risk of bleeding by the combination of Lepirudin and Anistreplase.	Myocardial infarction [BA41-BA43]	[26]
Prasugrel	DM7MT6E	Major	Increased risk of bleeding by the combination of Lepirudin and Prasugrel.	Myocardial infarction [BA41-BA43]	[12]
Vorapaxar	DMA16BR	Major	Increased risk of bleeding by the combination of Lepirudin and Vorapaxar.	Myocardial infarction [BA41-BA43]	[27]
Tenecteplase	DMJYN25	Major	Increased risk of bleeding by the combination of Lepirudin and Tenecteplase.	Myocardial infarction [BA41-BA43]	[26]
Reteplase	DML0D1P	Major	Increased risk of bleeding by the combination of Lepirudin and Reteplase.	Myocardial infarction [BA41-BA43]	[26]
Tirofiban	DMQG17S	Major	Increased risk of bleeding by the combination of Lepirudin and Tirofiban.	Myocardial infarction [BA41-BA43]	[6]
Sibutramine	DMFJTDI	Moderate	Increased risk of bleeding by the combination of Lepirudin and Sibutramine.	Obesity [5B80-5B81]	[28]
Dexfenfluramine	DMJ7YDS	Moderate	Increased risk of bleeding by the combination of Lepirudin and Dexfenfluramine.	Obesity [5B80-5B81]	[28]
Diclofenac	DMPIHLS	Moderate	Increased risk of bleeding by the combination of Lepirudin and Diclofenac.	Osteoarthritis [FA00-FA05]	[6]
Nepafenac	DMYK490	Moderate	Increased risk of bleeding by the combination of Lepirudin and Nepafenac.	Osteoarthritis [FA00-FA05]	[19]
Naproxen	DMZ5RGV	Moderate	Increased risk of bleeding by the combination of Lepirudin and Naproxen.	Osteoarthritis [FA00-FA05]	[6]
MK-4827	DMLYGH4	Moderate	Increased risk of bleeding by the combination of Lepirudin and MK-4827.	Ovarian cancer [2C73]	[12]
Aspirin	DM672AH	Moderate	Increased risk of bleeding by the combination of Lepirudin and Aspirin.	Pain [MG30-MG3Z]	[6]
Etodolac	DM6WJO9	Moderate	Increased risk of bleeding by the combination of Lepirudin and Etodolac.	Pain [MG30-MG3Z]	[6]
Diflunisal	DM7EN8I	Moderate	Increased risk of bleeding by the combination of Lepirudin and Diflunisal.	Pain [MG30-MG3Z]	[6]
Ibuprofen	DM8VCBE	Moderate	Increased risk of bleeding by the combination of Lepirudin and Ibuprofen.	Pain [MG30-MG3Z]	[6]
Nabumetone	DMAT2XH	Moderate	Increased risk of bleeding by the combination of Lepirudin and Nabumetone.	Pain [MG30-MG3Z]	[6]
Piroxicam	DMTK234	Moderate	Increased risk of bleeding by the combination of Lepirudin and Piroxicam.	Pain [MG30-MG3Z]	[6]
Choline salicylate	DM8P137	Moderate	Increased risk of bleeding by the combination of Lepirudin and Choline salicylate.	Postoperative inflammation [1A00-CA43]	[29]
Ketorolac	DMI4EL5	Moderate	Increased risk of bleeding by the combination of Lepirudin and Ketorolac.	Postoperative inflammation [1A00-CA43]	[6]
Bromfenac	DMKB79O	Moderate	Increased risk of bleeding by the combination of Lepirudin and Bromfenac.	Postoperative inflammation [1A00-CA43]	[6]
Treprostinil	DMTIQF3	Moderate	Increased risk of bleeding by the combination of Lepirudin and Treprostinil.	Pulmonary hypertension [BB01]	[30]
Epoprostenol	DMUTYR2	Moderate	Increased risk of bleeding by the combination of Lepirudin and Epoprostenol.	Pulmonary hypertension [BB01]	[30]
Iloprost	DMVPZBE	Moderate	Increased risk of bleeding by the combination of Lepirudin and Iloprost.	Pulmonary hypertension [BB01]	[30]
Alteplase	DMRJ3YX	Major	Increased risk of bleeding by the combination of Lepirudin and Alteplase.	Pulmonary thromboembolism [BB00]	[26]
Salsalate	DM13P4C	Moderate	Increased risk of bleeding by the combination of Lepirudin and Salsalate.	Rheumatoid arthritis [FA20]	[31]
Meloxicam	DM2AR7L	Moderate	Increased risk of bleeding by the combination of Lepirudin and Meloxicam.	Rheumatoid arthritis [FA20]	[6]
Sulindac	DM2QHZU	Moderate	Increased risk of bleeding by the combination of Lepirudin and Sulindac.	Rheumatoid arthritis [FA20]	[6]
Oxaprozin	DM9UB0P	Moderate	Increased risk of bleeding by the combination of Lepirudin and Oxaprozin.	Rheumatoid arthritis [FA20]	[6]
Flurbiprofen	DMGN4BY	Moderate	Increased risk of bleeding by the combination of Lepirudin and Flurbiprofen.	Rheumatoid arthritis [FA20]	[6]
Fenoprofen	DML5VQ0	Moderate	Increased risk of bleeding by the combination of Lepirudin and Fenoprofen.	Rheumatoid arthritis [FA20]	[6]
Indomethacin	DMSC4A7	Moderate	Increased risk of bleeding by the combination of Lepirudin and Indomethacin.	Rheumatoid arthritis [FA20]	[6]
Tolmetin	DMWUIJE	Moderate	Increased risk of bleeding by the combination of Lepirudin and Tolmetin.	Rheumatoid arthritis [FA20]	[6]
Salicyclic acid	DM2F8XZ	Moderate	Increased risk of bleeding by the combination of Lepirudin and Salicyclic acid.	Seborrhoeic dermatitis [EA81]	[29]
Curcumin	DMQPH29	Minor	Increased risk of bleeding by the combination of Lepirudin and Curcumin.	Solid tumour/cancer [2A00-2F9Z]	[32]
Warfarin	DMJYCVW	Major	Increased risk of bleeding by the combination of Lepirudin and Warfarin.	Supraventricular tachyarrhythmia [BC81]	[11]
Anagrelide	DMSQ8MD	Major	Increased risk of bleeding by the combination of Lepirudin and Anagrelide.	Thrombocytosis [3B63]	[6]
Apixaban	DM89JLN	Major	Increased risk of bleeding by the combination of Lepirudin and Apixaban.	Thrombosis [DB61-GB90]	[12]
Cangrelor	DM8JRH0	Major	Increased risk of bleeding by the combination of Lepirudin and Cangrelor.	Thrombosis [DB61-GB90]	[33]
Brilinta	DMBR01X	Moderate	Increased risk of bleeding by the combination of Lepirudin and Brilinta.	Thrombosis [DB61-GB90]	[12]
Dicumarol	DMFQCB1	Major	Increased risk of bleeding by the combination of Lepirudin and Dicumarol.	Thrombosis [DB61-GB90]	[11]
Clopidogrel	DMOL54H	Major	Increased risk of bleeding by the combination of Lepirudin and Clopidogrel.	Thrombosis [DB61-GB90]	[6]
Cabozantinib	DMIYDT4	Major	Increased risk of bleeding by the combination of Lepirudin and Cabozantinib.	Thyroid cancer [2D10]	[34]
Betrixaban	DM2C4RF	Major	Increased risk of bleeding by the combination of Lepirudin and Betrixaban.	Venous thromboembolism [BD72]	[33]
-----------


⏷ Show the Full List of 94 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6469).
2	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3	Recombinant hirudin (lepirudin) as anticoagulant in intensive care patients treated with continuous hemodialysis. Kidney Int Suppl. 1999 Nov;(72):S46-50.
4	Product Information. Angiomax (bivalirudin) The Medicines Compny, Cambridge, MA.
5	Cerner Multum, Inc. "Australian Product Information.".
6	Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
7	Booth SL, Golly I, Sacheck JM, Roubenoff R, Dallal GE, et al "Effect of vitamin E supplementation on vitamin K status in adults with normal coagulation status." Am J Clin Nutr 80 (2004): 143-8. [PMID: 15213041]
8	Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
9	Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
10	Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
11	Bates ER, Mukherjee D, Lau WC "Drug-drug interactions involving antiplatelet agents." Eur Heart J 24 (2003): 1707-9. [PMID: 14522564]
12	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
13	Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
14	Product Information. Fragmin (dalteparin). Pharmacia and Upjohn, Kalamazoo, MI.
15	Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
16	Product Information. Panhematin (hemin). Recordati Rare Diseases Inc, Lebanon, NJ.
17	Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
18	Canadian Pharmacists Association.
19	Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
20	Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
21	Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
22	Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
23	Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
24	Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
25	Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
26	Product Information. Refludan (lepirudin). Hoechst Marion-Roussel Inc, Kansas City, MO.
27	Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
28	Bannister SJ, Houser VP, Hulse JD, Kisicki JC, Rasmussen JG "Evaluation of the potential for interactions of paroxetine with diazepam, cimetidine, warfarin, and digoxin." Acta Psychiatr Scand Suppl 350 (1989): 102-6. [PMID: 2530759]
29	Fausa O "Salicylate-induced hypoprothrombinemia: a report of four cases." Acta Med Scand 188 (1970): 403-8. [PMID: 5490567]
30	Product Information. Flolan (epoprostenol). Glaxo Wellcome, Research Triangle Park, NC.
31	Richards JR, Garber D, Laurin EG, et al. Treatment of cocaine cardiovascular toxicity: a systematic review.?Clin Toxicol (Phila). 2016;54(5):345-364. [PMID: 26919414]
32	Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
33	Bodiford AB, Kessler FO, Fermo JD, Ragucci KR "Elevated international normalized ratio with the consumption of grapefruit and use of warfarin." SAGE Open Med Case Rep 0 (2013): 1-3. [PMID: 27489634]
34	Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.