Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTGP7BY)

DTT Name	Monoamine oxidase type B (MAO-B)
Synonyms	MAO-B; Amine oxidase [flavin-containing] B
Gene Name	MAOB
DTT Type	Successful target	[1]
BioChemical Class	CH-NH(2) donor oxidoreductase
UniProt ID	AOFB_HUMAN
TTD ID	T83011
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 1.4.3.4
Sequence	MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Function	Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine.
KEGG Pathway	Glycine, serine and threonine metabolism (hsa00260 ) Arginine and proline metabolism (hsa00330 ) Histidine metabolism (hsa00340 ) Tyrosine metabolism (hsa00350 ) Phenylalanine metabolism (hsa00360 ) Tryptophan metabolism (hsa00380 ) Drug metabolism - cytochrome P450 (hsa00982 ) Metabolic pathways (hsa01100 ) Serotonergic synapse (hsa04726 ) Dopaminergic synapse (hsa04728 ) Cocaine addiction (hsa05030 ) Amphetamine addiction (hsa05031 ) Alcoholism (hsa05034 )
Reactome Pathway	Biogenic amines are oxidatively deaminated to aldehydes by MAOA and MAOB (R-HSA-141333 )
BioCyc Pathway	MetaCyc:HS00966-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

11 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Budipine	DMODHQI	Migraine	8A80	Approved	[2]
Indeloxazine	DMWO3N6	Dementia	6D80-6D86	Approved	[3]
Pargyline	DMM0HR1	Hypertension	BA00-BA04	Approved	[4]
Phenelzine	DMHIDUE	Depression	6A70-6A7Z	Approved	[5]
Rasagiline	DM3WKQ4	Parkinson disease	8A00.0	Approved	[6]
Safinamide	DM0YWJC	Parkinson disease	8A00.0	Approved	[7]
Safinamide mesylate	DM0J2ZT	Parkinson disease	8A00.0	Approved	[8]
Selegiline	DM6034S	Major depressive disorder	6A70.3	Approved	[9]
Selegiline Hydrochloride	DM3VR1L	Parkinson disease	8A00.0	Approved	[10]
Sulphadoxine	DMZI2UF	Malaria	1F40-1F45	Approved	[11]
Tranylcypromine	DMGB5RE	Major depressive disorder	6A70.3	Approved	[1]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Approved Drug(s)

11 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
P2B-001	DM9PVHX	Parkinson disease	8A00.0	Phase 3	[12]
Psoralen	DMIZJ8M	N. A.	N. A.	Phase 3	[13]
TRYPTAMINE	DMAFPHB	N. A.	N. A.	Phase 3	[14]
CHF-3381	DMQ2O8V	Neuropathic pain	8E43.0	Phase 2	[15]
EVT302	DM73XNG	Alzheimer disease	8A20	Phase 2	[16]
Ladostigil	DMJSY3Q	Alzheimer disease	8A20	Phase 2	[17]
ORY-2001	DMYM0UY	Alzheimer disease	8A20	Phase 2	[18]
RG1577	DMT1ZX0	Alzheimer disease	8A20	Phase 2	[19]
Neu-120	DMXKOUC	Parkinson disease	8A00.0	Phase 1/2	[20]
PIPERINE	DMYEAB1	Vitiligo	ED63.0	Phase 1/2	[21]
PF9601N	DMGLEM1	Parkinson disease	8A00.0	Phase 1	[22]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Clinical Trial Drug(s)

73 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
3,4-Dihydroxybenzaldehyde	DM4O3DW	N. A.	N. A.	Patented	[23]
3-Hydroxy-2-butanone	DM9GPKR	N. A.	N. A.	Patented	[23]
4-Hydroxy-2,5-dimethyl-3(2H)-furanone	DM9L5KO	N. A.	N. A.	Patented	[23]
4-hydroxybenzaldehyde	DM471P5	Discovery agent	N.A.	Patented	[23]
4-Hydroxybenzoicacid	DM3WQNY	N. A.	N. A.	Patented	[23]
4-Hydroxybenzylalcohol	DMKDZMQ	N. A.	N. A.	Patented	[23]
4-Methoxybenzaldehyde	DMN6GTZ	N. A.	N. A.	Patented	[23]
Benzylcinnamate	DMD7Z3H	N. A.	N. A.	Patented	[23]
Coumaricacid	DM3ZGBH	N. A.	N. A.	Patented	[23]
Coumarin/resveratrol hybrid derivative 1	DMI1BKA	N. A.	N. A.	Patented	[24]
Coumarin/resveratrol hybrid derivative 2	DMK12OT	N. A.	N. A.	Patented	[24]
Cyclic peptide derivative 1	DM78NOU	N. A.	N. A.	Patented	[25]
Ethylvanillin	DM9WMJ1	N. A.	N. A.	Patented	[23]
EUGENOL	DM7US1H	Discovery agent	N.A.	Patented	[23]
FERULIC ACID	DMJC7NF	Discovery agent	N.A.	Patented	[23]
Heteroaryl-cyclopropylamine derivative 1	DMRF58Q	N. A.	N. A.	Patented	[25]
Heteroaryl-cyclopropylamine derivative 3	DMH9EQ1	N. A.	N. A.	Patented	[25]
Lazabemide	DMCULK7	Skin imperfections	EK71	Patented	[26]
Lazabemide analog 1	DM189D7	N. A.	N. A.	Patented	[24]
N-(2-phenylcyclopropyl) amino acid derivative 1	DMH7T8C	N. A.	N. A.	Patented	[25]
N-(2-phenylcyclopropyl) amino acid derivative 3	DMFBRSL	N. A.	N. A.	Patented	[25]
Piperonal	DME26SY	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 6-10	DM4UM03	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 6-11	DMYGTU2	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 6-12	DMZ07RP	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 6-13	DM6LR42	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 6-14	DMZHB9Y	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 6-15	DMCHWSF	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 6-9	DMDWIPG	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 7-Vanillic acid	DMSL3MB	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 7-Vanillyl alcohol	DM759MJ	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table 7-Veratraldehyde	DM4J2SM	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C1	DMMP7HX	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C10	DMWY5XT	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C11	DMVASXW	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C12	DMF9X6P	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C13	DMD80Q6	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C14	DM7960M	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C15	DMR0P1U	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C16	DMYTEAC	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C17	DMNMU3R	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C18	DM2ZUVH	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C19	DMMO3F1	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C2	DMPFLGO	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C20	DMITNWZ	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C21	DMMFILA	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C22	DMBE0R2	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C23	DMF89PY	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C24	DMJK296	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C25	DMHT41B	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C3	DMXAKNH	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C4	DMJCVBM	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C5	DMEJNUG	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C6	DMY3UKC	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C7	DMQJV3L	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C8	DMRCPKV	N. A.	N. A.	Patented	[23]
PMID25399762-Compound-Table1-C9	DMVMT26	N. A.	N. A.	Patented	[23]
PMID29324067-Compound-38	DMPXZYN	N. A.	N. A.	Patented	[24]
PMID29324067-Compound-40	DM69A05	N. A.	N. A.	Patented	[24]
PMID29757691-Compound-4	DMFD9UZ	N. A.	N. A.	Patented	[27]
Schiff base compound 1	DMQD6IL	Alzheimer disease	8A20	Patented	[24]
Schiff base compound 2	DMWD20L	Alzheimer disease	8A20	Patented	[24]
Secondary and tertiary (hetero)arylamide derivative 1	DMEDNTJ	N. A.	N. A.	Patented	[24]
T83193	DMHO29Y	Discovery agent	N.A.	Patented	[23]
Tacrine-coumarin hybrid derivative 1	DM6YBTR	N. A.	N. A.	Patented	[24]
Tarnylcypromine derivative 2	DMEJR2F	N. A.	N. A.	Patented	[25]
Tarnylcypromine derivative 3	DMKJOMC	N. A.	N. A.	Patented	[25]
Tetra-hydro-isoquinoline derivative 1	DML86IO	N. A.	N. A.	Patented	[27]
Tetra-hydro-isoquinoline derivative 2	DM5CKVF	N. A.	N. A.	Patented	[27]
Tetra-hydro-isoquinoline derivative 3	DMCZA45	N. A.	N. A.	Patented	[27]
Tetra-hydro-isoquinoline derivative 4	DMDV0MP	N. A.	N. A.	Patented	[27]
Tetra-hydro-oxazolopyridine derivative 1	DM72MDA	N. A.	N. A.	Patented	[28]
Tetra-hydro-oxazolopyridine derivative 2	DMP65Z4	N. A.	N. A.	Patented	[28]
------------------------------------------------------------------------------------


⏷ Show the Full List of 73 Patented Agent(s)

6 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MOFEGILINE	DMJ59A4	Cognitive impairment	6D71	Discontinued in Phase 3	[29]
AS602868	DMKXDOI	Multiple myeloma	2A83	Discontinued in Phase 1	[13]
EVT-301	DMCZ8SF	Alzheimer disease	8A20	Discontinued in Phase 1	[30]
HT-1067	DMUPOIG	Parkinson disease	8A00.0	Discontinued in Phase 1	[31]
SL-25.1188	DMP0DLW	Alzheimer disease	8A20	Discontinued in Phase 1	[32]
Milacemide	DMJTR0U	Alzheimer disease	8A20	Terminated	[33]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Discontinued Drug(s)

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RWJ-416457	DMH1FRY	Bacterial infection	1A00-1C4Z	Preclinical	[9]
------------------------------------------------------------------------------------

237 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-2-(4'-Benzyloxyphenyl)thiomorpholin-5-one	DMDXKQ6	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine	DMCB74T	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one	DM1WCJV	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholine	DMG3MF2	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one	DM1YBJ2	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholine	DMKPX7W	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one	DM7BY4T	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholine	DMKFSQ8	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholin-5-one	DMY1W20	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholine	DMUPYN1	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-(4-fluorophenyl)-7-methoxychroman-4-one	DMGY5WB	Discovery agent	N.A.	Investigative	[35]
(+/-)-2-(4-fluorophenyl)-7-methylchroman-4-one	DMHL7BC	Discovery agent	N.A.	Investigative	[35]
(+/-)-2-(4-fluorophenyl)chroman-4-one	DMXK4HR	Discovery agent	N.A.	Investigative	[35]
(+/-)-2-(4-methoxyphenyl)-7-methylchroman-4-one	DMTUFOE	Discovery agent	N.A.	Investigative	[35]
(+/-)-2-p-tolylchroman-4-one	DMYJGZ4	Discovery agent	N.A.	Investigative	[35]
(+/-)-2-Phenylthiomorpholin-5-one	DMSHDNO	Discovery agent	N.A.	Investigative	[34]
(+/-)-2-Phenylthiomorpholine	DMNR3YL	Discovery agent	N.A.	Investigative	[34]
(+/-)-7-fluoro-2-(4-fluorophenyl)chroman-4-one	DMKWBY8	Discovery agent	N.A.	Investigative	[35]
(+/-)-7-fluoro-2-(4-methoxyphenyl)chroman-4-one	DMYHV9P	Discovery agent	N.A.	Investigative	[35]
(+/-)-7-fluoro-2-p-tolylchroman-4-one	DM4H1JO	Discovery agent	N.A.	Investigative	[35]
(+/-)-7-fluoro-2-phenylchroman-4-one	DMJEBXA	Discovery agent	N.A.	Investigative	[35]
(+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one	DMYJGDK	Discovery agent	N.A.	Investigative	[35]
(+/-)-7-methoxy-2-p-tolylchroman-4-one	DMJMTVQ	Discovery agent	N.A.	Investigative	[35]
(+/-)-7-methoxy-2-phenylchroman-4-one	DMC0OKA	Discovery agent	N.A.	Investigative	[35]
(+/-)-7-methyl-2-p-tolylchroman-4-one	DMBN3WE	Discovery agent	N.A.	Investigative	[35]
(+/-)-7-methyl-2-phenylchroman-4-one	DMI3URD	Discovery agent	N.A.	Investigative	[35]
(6-Benzyloxy-2-naphthyl)-2-aminopropane	DMF7LST	Discovery agent	N.A.	Investigative	[36]
(6-Ethoxy-2-naphthyl)-2-aminopropane	DMM2EX6	Discovery agent	N.A.	Investigative	[36]
(6-Methoxy-2-naphthyl)-2-aminopropane	DM6YGQ3	Discovery agent	N.A.	Investigative	[36]
(6-Propoxy-2-naphthyl)-2-aminopropane	DMIFL3V	Discovery agent	N.A.	Investigative	[36]
(7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile	DMB9YAO	Discovery agent	N.A.	Investigative	[37]
(E)-5-(3-Chlorostyryl)isatin	DMLIQUA	Discovery agent	N.A.	Investigative	[38]
(E)-5-(3-Fluorostyryl)isatin	DMP4T9Z	Discovery agent	N.A.	Investigative	[38]
(E)-5-Styrylisatin	DM1PCIX	Discovery agent	N.A.	Investigative	[38]
(E)-6-Styrylisatin	DMG47QU	Discovery agent	N.A.	Investigative	[38]
(E)-8-(3-chlorostyryl)-caffeine	DMQT15Z	Discovery agent	N.A.	Investigative	[39]
(R)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one	DM5UOFY	Discovery agent	N.A.	Investigative	[35]
(R)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one	DM6WTLZ	Discovery agent	N.A.	Investigative	[35]
(R)(+)-7-fluoro-2-p-tolylchroman-4-one	DMHNKWR	Discovery agent	N.A.	Investigative	[35]
(R)(+)-7-fluoro-2-phenylchroman-4-one	DMJCN0Y	Discovery agent	N.A.	Investigative	[35]
(R)(+)-7-methyl-2-p-tolylchroman-4-one	DMVN50D	Discovery agent	N.A.	Investigative	[35]
(R)(+)-7-methyl-2-phenylchroman-4-one	DM8ZHYR	Discovery agent	N.A.	Investigative	[35]
(R)-3-Prop-2-ynylamino-indan-5-ol	DMPEV2W	Discovery agent	N.A.	Investigative	[40]
(R)-Indan-1-yl-methyl-prop-2-ynyl-amine	DMKFPMC	Discovery agent	N.A.	Investigative	[41]
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide	DMPKWIN	Discovery agent	N.A.	Investigative	[42]
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide	DMEVM6G	Discovery agent	N.A.	Investigative	[42]
(R)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}alaninamide	DMU49JN	Discovery agent	N.A.	Investigative	[42]
(R/R)BEFLOXATONE	DM8I6MG	Discovery agent	N.A.	Investigative	[43]
(S)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one	DMC5Z2I	Discovery agent	N.A.	Investigative	[35]
(S)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one	DMILWE7	Discovery agent	N.A.	Investigative	[35]
(S)(+)-7-fluoro-2-p-tolylchroman-4-one	DMTFZBQ	Discovery agent	N.A.	Investigative	[35]
(S)(+)-7-fluoro-2-phenylchroman-4-one	DMHR1IB	Discovery agent	N.A.	Investigative	[35]
(S)(+)-7-methyl-2-p-tolylchroman-4-one	DMVBD6H	Discovery agent	N.A.	Investigative	[35]
(S)(+)-7-methyl-2-phenylchroman-4-one	DMBG4KN	Discovery agent	N.A.	Investigative	[35]
(S)-2-amino-1-(4-butylthiophenyl)-propane	DMPQ53V	Discovery agent	N.A.	Investigative	[44]
(S)-2-amino-1-(4-propylthiophenyl)-propane	DMAN7YJ	Discovery agent	N.A.	Investigative	[44]
(S)-N2-[4-(benzyloxy)benzyl]alaninamide	DMGMAPB	Discovery agent	N.A.	Investigative	[42]
(S)-N2-[4-(benzyloxy)benzyl]serinamide	DMW5ZK7	Discovery agent	N.A.	Investigative	[42]
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide	DMKMJBL	Discovery agent	N.A.	Investigative	[42]
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide	DMINLCJ	Discovery agent	N.A.	Investigative	[42]
(S)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}serinamide	DMSC8ZW	Discovery agent	N.A.	Investigative	[42]
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}alaninamide	DMU3F7H	Discovery agent	N.A.	Investigative	[42]
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}serinamide	DMLFOPV	Discovery agent	N.A.	Investigative	[42]
(S)-N2-{4-[(4-nitrobenzyl)oxy]benzyl}serinamide	DMLP63J	Discovery agent	N.A.	Investigative	[42]
1,2,3,4-Tetrahydro-naphthalen-1-ylamine	DMNXQ7Z	Discovery agent	N.A.	Investigative	[45]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole	DM3JGVF	Discovery agent	N.A.	Investigative	[46]
1,4-diphenyl-(1E,3E)-1,3-butadiene	DMFY3VS	Discovery agent	N.A.	Investigative	[41]
1-(4-(benzyloxy)phenyl)propan-2-amine	DMT81N3	Discovery agent	N.A.	Investigative	[36]
1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	DMPWB8G	Discovery agent	N.A.	Investigative	[47]
1H-Indole-2,3-dione	DMOZ91H	Discovery agent	N.A.	Investigative	[48]
2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole	DMX8NYD	Discovery agent	N.A.	Investigative	[14]
2-(2,4-dichlorophenyl)-4,5-dihydro-1H-imidazole	DMDUF21	Discovery agent	N.A.	Investigative	[49]
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole	DM187UQ	Discovery agent	N.A.	Investigative	[50]
2-(2-cyclohexylidenehydrazinyl)-4-p-tolylthiazole	DMTFWAQ	Discovery agent	N.A.	Investigative	[50]
2-(2-cyclohexylidenehydrazinyl)-4-phenylthiazole	DMPNGXE	Discovery agent	N.A.	Investigative	[50]
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole	DMH1VCE	Discovery agent	N.A.	Investigative	[50]
2-(3-nitrophenyl)-4,5-dihydro-1H-imidazole	DMMYQ9R	Discovery agent	N.A.	Investigative	[49]
2-(4,5-dihydro-1H-imidazol-2-yl)quinoline	DM4X0SJ	Discovery agent	N.A.	Investigative	[49]
2-(4-chlorophenyl)-4,5-dihydro-1H-imidazole	DMFQI4C	Discovery agent	N.A.	Investigative	[49]
2-(4-fluorophenyl)-7-methoxy-4H-chromen-4-one	DMZDGB3	Discovery agent	N.A.	Investigative	[35]
2-(4-methoxyphenyl)-4H-chromene-4-thione	DMIDXTR	Discovery agent	N.A.	Investigative	[35]
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole	DMDZ9RK	Discovery agent	N.A.	Investigative	[51]
2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole	DMKY71Z	Discovery agent	N.A.	Investigative	[49]
2-BFi	DMFAW4R	Discovery agent	N.A.	Investigative	[49]
2-Bromo-N-(2-morpholinoethyl)nicotinamide	DMYCENM	Discovery agent	N.A.	Investigative	[52]
2-Bromo-N-(3-morpholinopropyl)nicotinamide	DM9NMIO	Discovery agent	N.A.	Investigative	[52]
2-Chloro-N-(2-morpholinoethyl)nicotinamide	DMR8M36	Discovery agent	N.A.	Investigative	[52]
2-Chloro-N-(3-morpholinopropyl)nicotinamide	DM5S1DW	Discovery agent	N.A.	Investigative	[52]
2-Furan-2-yl-4,5-dihydro-1H-imidazole	DMQIFJ9	Discovery agent	N.A.	Investigative	[53]
2-Hydrazino-3-methyl-4(3H)-quinazolinone	DMOT1LQ	Discovery agent	N.A.	Investigative	[54]
2-methyl-9H-indeno[2,1-d]pyrimidin-9-one	DMEVFJW	Discovery agent	N.A.	Investigative	[55]
2-oxo-N-m-tolyl-2H-chromene-3-carboxamide	DMDKSZ0	Discovery agent	N.A.	Investigative	[56]
2-oxo-N-p-tolyl-2H-chromene-3-carboxamide	DMWXI6C	Discovery agent	N.A.	Investigative	[56]
2-oxo-N-phenyl-2H-chromene-3-carboxamide	DMH8QWY	Discovery agent	N.A.	Investigative	[56]
2-p-tolyl-4,5-dihydro-1H-imidazole	DM37S5C	Discovery agent	N.A.	Investigative	[49]
2-p-tolyl-4H-chromen-4-one	DMFWA9Y	Discovery agent	N.A.	Investigative	[35]
2-p-tolyl-4H-chromene-4-thione	DM2HKCM	Discovery agent	N.A.	Investigative	[35]
2-Phenethyl-4,5-dihydro-1H-imidazole	DM4H6PC	Discovery agent	N.A.	Investigative	[53]
2-Phenoxymethyl-4,5-dihydro-1H-imidazole	DM5E74G	Discovery agent	N.A.	Investigative	[53]
2-phenyl-9H-indeno[2,1-d]pyrimidine	DMMHSYV	Discovery agent	N.A.	Investigative	[55]
2-Phenyl-cyclopropylamine hydrochloride	DMUGH6J	Discovery agent	N.A.	Investigative	[57]
2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide	DMZFKDW	Discovery agent	N.A.	Investigative	[37]
3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin	DMN4Z27	Discovery agent	N.A.	Investigative	[58]
3,4-Benzo-7-acetonyloxy-8-methoxycoumarin	DM1MC06	Discovery agent	N.A.	Investigative	[58]
3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide	DMMZURL	Discovery agent	N.A.	Investigative	[59]
3-(2-Bromophenyl)-6-methylcoumarin	DMDM0R6	Discovery agent	N.A.	Investigative	[60]
3-(3-methoxyphenyl)-6-methyl-2H-chromen-2-one	DMZQ2CJ	Discovery agent	N.A.	Investigative	[61]
3-(4-hydroxyphenyl)-6-methyl-2H-chromen-2-one	DM3XOVL	Discovery agent	N.A.	Investigative	[61]
3-(4-methoxyphenyl)-6-methyl-2H-chromen-2-one	DMXKJOC	Discovery agent	N.A.	Investigative	[61]
3-(phenoxymethyl)-5H-indeno[1,2-c]pyridazin-5-one	DM2UPQG	Discovery agent	N.A.	Investigative	[55]
3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide	DMIEZGD	Discovery agent	N.A.	Investigative	[59]
3-phenyl-9H-indeno[1,2-e][1,2,4]triazin-9-one	DM830FW	Discovery agent	N.A.	Investigative	[55]
4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin	DMQNXL1	Discovery agent	N.A.	Investigative	[58]
4,9-Dihydro-3H-beta-carboline	DM27HMT	Discovery agent	N.A.	Investigative	[46]
4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid	DMWIALU	Discovery agent	N.A.	Investigative	[56]
4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one	DMTB80W	Discovery agent	N.A.	Investigative	[37]
4-fluoroselegiline	DMRC49E	Dementia	6D80-6D86	Investigative	[62]
4-HYDROXY-N-PROPARGYL-1(R)-AMINOINDAN	DMNMJDL	Discovery agent	N.A.	Investigative	[40]
4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one	DM9K7CQ	Discovery agent	N.A.	Investigative	[58]
4-oxo-4H-chromene-3-carboxylic acid	DM7GW4P	Discovery agent	N.A.	Investigative	[63]
4-phenyl-1,2,3,6-tetrahydropyridine	DMV6WC4	Discovery agent	N.A.	Investigative	[47]
5-Aminomethyl-3-pyrrol-1-yl-oxazolidin-2-one	DMWDUVC	Discovery agent	N.A.	Investigative	[43]
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMMI4H3	Discovery agent	N.A.	Investigative	[14]
5-Bromo-4,9-dihydro-3H-beta-carboline	DM2SEFR	Discovery agent	N.A.	Investigative	[14]
5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one	DMT9FQN	Discovery agent	N.A.	Investigative	[43]
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMNRSYA	Discovery agent	N.A.	Investigative	[14]
5-Methoxy-4,9-dihydro-3H-beta-carboline	DMBOMZE	Discovery agent	N.A.	Investigative	[14]
5-QUINOXALIN-6-YLMETHYLENE-THIAZOLIDINE-2,4-DIONE	DMVX063	Discovery agent	N.A.	Investigative	[64]
6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one	DMU1CV4	Discovery agent	N.A.	Investigative	[58]
6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMXQ8K1	Discovery agent	N.A.	Investigative	[14]
6-Bromo-4,9-dihydro-3H-beta-carboline	DM64KOZ	Discovery agent	N.A.	Investigative	[14]
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMSA367	Discovery agent	N.A.	Investigative	[46]
6-Methoxy-4,9-dihydro-3H-beta-carboline	DM98FQO	Discovery agent	N.A.	Investigative	[46]
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin	DM762G3	Discovery agent	N.A.	Investigative	[65]
7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin	DMQCDT1	Discovery agent	N.A.	Investigative	[58]
7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin	DMQMTSX	Discovery agent	N.A.	Investigative	[58]
7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMVTH0Q	Discovery agent	N.A.	Investigative	[14]
7-Bromo-4,9-dihydro-3H-beta-carboline	DMCWYT7	Discovery agent	N.A.	Investigative	[14]
7-fluoro-2-(4-fluorophenyl)-4H-chromene-4-thione	DM4HJZI	Discovery agent	N.A.	Investigative	[35]
7-fluoro-2-(4-methoxyphenyl)-4H-chromen-4-one	DMUPXBJ	Discovery agent	N.A.	Investigative	[35]
7-fluoro-2-p-tolyl-4H-chromen-4-one	DMFOU8G	Discovery agent	N.A.	Investigative	[35]
7-fluoro-2-p-tolyl-4H-chromene-4-thione	DMJFXKA	Discovery agent	N.A.	Investigative	[35]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMQ1BE8	Discovery agent	N.A.	Investigative	[53]
7-methoxy-2-p-tolyl-4H-chromen-4-one	DME5WZQ	Discovery agent	N.A.	Investigative	[35]
7-methoxy-2-p-tolyl-4H-chromene-4-thione	DM4WMGK	Discovery agent	N.A.	Investigative	[35]
7-Methoxy-9H-beta-carboline	DMHKMU1	Discovery agent	N.A.	Investigative	[14]
7-methyl-2-p-tolyl-4H-chromene-4-thione	DMB9YA8	Discovery agent	N.A.	Investigative	[35]
8-(3-Bromobenzyloxy)caffeine	DM2RA4N	Discovery agent	N.A.	Investigative	[66]
8-(3-Chlorobenzyloxy)caffeine	DM7HMNP	Discovery agent	N.A.	Investigative	[66]
8-(3-Fluorobenzyloxy)caffeine	DME85GS	Discovery agent	N.A.	Investigative	[66]
8-(3-Methoxybenzyloxy)caffeine	DMLY46X	Discovery agent	N.A.	Investigative	[66]
8-(3-Methylbenzyloxy)caffeine	DMB9645	Discovery agent	N.A.	Investigative	[66]
8-Benzyloxycaffeine	DMJQ8AP	Discovery agent	N.A.	Investigative	[66]
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMALRU4	Discovery agent	N.A.	Investigative	[14]
8-Bromo-4,9-dihydro-3H-beta-carboline	DM4V5RU	Discovery agent	N.A.	Investigative	[14]
8-Bromo-6-methyl-3-(4'-methoxyphenyl)coumarin	DM51FL9	Discovery agent	N.A.	Investigative	[60]
8-Bromo-6-methyl-3-phenylcoumarin	DMD1LM8	Discovery agent	N.A.	Investigative	[60]
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMHE7J5	Discovery agent	N.A.	Investigative	[14]
8-Methoxy-4,9-dihydro-3H-beta-carboline	DM8MBSN	Discovery agent	N.A.	Investigative	[14]
8-[(3-Trifluoromethyl)benzyloxy]caffeine	DMT3IOB	Discovery agent	N.A.	Investigative	[66]
9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline	DMF7QS5	Discovery agent	N.A.	Investigative	[14]
Benzyl-methyl-[1-(1H-pyrrol-2-yl)-vinyl]-amine	DMQAEOL	Discovery agent	N.A.	Investigative	[67]
Beta-methoxyamphetamine	DMA9CSG	Discovery agent	N.A.	Investigative	[68]
Butyl-methyl-prop-2-ynyl-amine hydrochloride	DMJUTWG	Discovery agent	N.A.	Investigative	[69]
C-(1H-Indol-3-yl)-methylamine	DMDLK9G	Discovery agent	N.A.	Investigative	[14]
CGS-19281A	DMDB2KJ	Discovery agent	N.A.	Investigative	[46]
CHALCONE	DM16QTM	Discovery agent	N.A.	Investigative	[70]
Cis-2-(4-chlorophenyl)-2-fluorocyclopropanamine	DMVRF9H	Discovery agent	N.A.	Investigative	[71]
Cis-2-(para-fluorophenyl)cyclopropylamine	DMPZ1LY	Discovery agent	N.A.	Investigative	[71]
Cis-2-Fluoro-2-(4-methoxyphenyl)cyclopropylamine	DMNG9B2	Discovery agent	N.A.	Investigative	[71]
Cis-2-fluoro-2-phenylcyclopropanamine	DMFSPHE	Discovery agent	N.A.	Investigative	[71]
Cis-2-phenylcyclopropylamine	DMKZ32J	Discovery agent	N.A.	Investigative	[71]
CORDOIN	DMT5SED	Discovery agent	N.A.	Investigative	[70]
Deprenyl	DMRFBD0	Discovery agent	N.A.	Investigative	[72]
Farnesol	DMV2X1B	Discovery agent	N.A.	Investigative	[40]
Flavanone	DMNWIYM	Discovery agent	N.A.	Investigative	[35]
Flavin-Adenine Dinucleotide	DM5S4GK	Discovery agent	N.A.	Investigative	[73]
Heptyl-methyl-prop-2-ynyl-amine hydrochloride	DM1NUO5	Discovery agent	N.A.	Investigative	[69]
HYDRAZINECARBOXAMIDE	DMARWG5	Discovery agent	N.A.	Investigative	[57]
IPRONIAZIDE	DM42ENF	Discovery agent	N.A.	Investigative	[52]
Isopropyl-methyl-prop-2-ynyl-amine hydrochloride	DM92F6Z	Discovery agent	N.A.	Investigative	[69]
JD-0100	DMLBX3Q	Obesity	5B81	Investigative	[9]
L-136662	DMWNJV0	Discovery agent	N.A.	Investigative	[64]
Lauryl Dimethylamine-N-Oxide	DM3W2OE	Discovery agent	N.A.	Investigative	[73]
LU-53439	DMGYBSC	Discovery agent	N.A.	Investigative	[74]
Methyl piperate	DMW2R3M	Discovery agent	N.A.	Investigative	[21]
Methyl-(1,2,3,4-tetrahydro-naphthalen-1-yl)-amine	DM9Y4FL	Discovery agent	N.A.	Investigative	[45]
Methyl-pentyl-prop-2-ynyl-amine oxalic acid	DMQ7THK	Discovery agent	N.A.	Investigative	[69]
MMDA	DMUWVGP	Discovery agent	N.A.	Investigative	[73]
N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine	DMCM51R	Discovery agent	N.A.	Investigative	[75]
N-(1H-Indol-2-ylmethyl)-N-phenylamine	DMXD592	Discovery agent	N.A.	Investigative	[75]
N-(2-aminoethyl)-2-oxo-2H-chromene-3-carboxamide	DM7SUTQ	Discovery agent	N.A.	Investigative	[56]
N-(2-aminoethyl)-p-chlorobenzamide	DMLSFQI	Discovery agent	N.A.	Investigative	[40]
N-(2-Methyl-1H-indol-5-yl)benzamide	DMH42YF	Discovery agent	N.A.	Investigative	[59]
N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide	DM3SF5M	Discovery agent	N.A.	Investigative	[59]
N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine	DM1ADE5	Discovery agent	N.A.	Investigative	[76]
N-(2-Phenylethyl)-1H-indole-2-carboxamide	DMJCO7F	Discovery agent	N.A.	Investigative	[75]
N-(3-Phenylpropyl)-1H-indole-2-carboxamide	DMKAX3Q	Discovery agent	N.A.	Investigative	[75]
N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide	DMWTVJH	Discovery agent	N.A.	Investigative	[56]
N-(4-Phenylbutyl)-1H-indole-2-carboxamide	DMTCMUG	Discovery agent	N.A.	Investigative	[75]
N-(benzyl),N-(pyrrol-2-ylmethyl)amine	DM87YJW	Discovery agent	N.A.	Investigative	[76]
N-(propargyl),N-(pyrrol-2-ylmethyl)amine	DMTJ5WL	Discovery agent	N.A.	Investigative	[76]
N-Benzyl,N-methyl-1H-indole-2-carboxamide	DMHVRFM	Discovery agent	N.A.	Investigative	[75]
N-Benzyl-1H-indole-2-carboxamide	DMA3YWU	Discovery agent	N.A.	Investigative	[75]
N-benzyl-2-oxo-2H-chromene-3-carboxamide	DMJ29MN	Discovery agent	N.A.	Investigative	[56]
N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine	DM0NJAL	Discovery agent	N.A.	Investigative	[75]
N-cyclohexyl-2-oxo-2H-chromene-3-carboxamide	DMRA548	Discovery agent	N.A.	Investigative	[56]
N-isobutyl-2-oxo-2H-chromene-3-carboxamide	DMO4E9U	Discovery agent	N.A.	Investigative	[56]
N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine	DM83AEM	Discovery agent	N.A.	Investigative	[76]
N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine	DMZ24XT	Discovery agent	N.A.	Investigative	[76]
N-Methyl,N-phenyl-1H-indole-2-carboxamide	DMM3B21	Discovery agent	N.A.	Investigative	[75]
N-Methyl-N-phenyl-2-oxo-2H-chromene-3-carboxamide	DMDB7ZM	Discovery agent	N.A.	Investigative	[56]
N-Methyl-N-Propargyl-1(R)-Aminoindan	DMB9OGI	Discovery agent	N.A.	Investigative	[40]
N-Phenyl-1H-indole-2-carboxamide	DM7V025	Discovery agent	N.A.	Investigative	[75]
N-Propargyl-1(S)-Aminoindan	DMHZCLV	Discovery agent	N.A.	Investigative	[40]
N2-[4-(benzyloxy)benzyl]glycinamide	DMOZ1IY	Discovery agent	N.A.	Investigative	[42]
N2-{4-[(3-chlorobenzyl)oxy]benzyl}glycinamide	DMHJ2IP	Discovery agent	N.A.	Investigative	[42]
N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide	DMEWP9L	Discovery agent	N.A.	Investigative	[42]
N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide	DMLPJGX	Discovery agent	N.A.	Investigative	[42]
N2-{4-[(4-nitrobenzyl)oxy]benzyl}glycinamide	DMAVB0G	Discovery agent	N.A.	Investigative	[42]
NSC-50187	DMTQP3V	Discovery agent	N.A.	Investigative	[35]
NSC-93405	DM3BZ7S	Discovery agent	N.A.	Investigative	[35]
NW-1772	DMRYBK6	Neurodegenerative disorder	8A20-8A23	Investigative	[9]
Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate	DMHDWTS	Discovery agent	N.A.	Investigative	[49]
PNU-22394	DMHTPSF	Discovery agent	N.A.	Investigative	[14]
RS-1636	DMKQT1Y	Discovery agent	N.A.	Investigative	[11]
SKL-PD	DM4X2GH	Central nervous system disease	8A04-8D87	Investigative	[9]
TOLOXATONE	DMHV5NK	Discovery agent	N.A.	Investigative	[43]
TRACIZOLINE	DM18CV3	Discovery agent	N.A.	Investigative	[53]
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine	DMH1S57	Discovery agent	N.A.	Investigative	[71]
Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine	DMO01T8	Discovery agent	N.A.	Investigative	[71]
Trans-2-fluoro-2-p-tolylcyclopropanamine	DM392QT	Discovery agent	N.A.	Investigative	[71]
Trans-2-fluoro-2-phenylcyclopropylamin	DMVGAFR	Discovery agent	N.A.	Investigative	[71]
TRYPTOLINE	DMV19K7	Discovery agent	N.A.	Investigative	[53]
VAR-10200	DMD7M9L	Neurodegenerative disorder	8A20-8A23	Investigative	[9]
VAR-10300	DMFKTPO	Neurodegenerative disorder	8A20-8A23	Investigative	[9]
[(1e)-4-Phenylbut-1-Enyl]Benzene	DMG1ATX	Discovery agent	N.A.	Investigative	[40]
------------------------------------------------------------------------------------


⏷ Show the Full List of 237 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Alzheimer's disease	8A00.0	Entorhinal cortex	2.65E-02	1.12E-02	0.07
Vitiligo	EA90	Skin	3.59E-01	0.02	0.08
Major depressive disorder	6A20	Pre-frontal cortex	3.49E-01	-0.02	-0.19
Parkinson's disease	8A00.0	Substantia nigra tissue	9.83E-01	0.04	0.19
------------------------------------------------------------------------------------

The Drug-Metabolizing Enzyme (DME) Role of This DTT

DTT DME Name

Monoamine oxidase type B (MAO-B) DME Info

Gene Name

MAOB

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dopamine	DMPGUCF	Acromegaly	5A60.0	Approved	[77]
------------------------------------------------------------------------------------

References

1	Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73.
2	Multiple mechanisms of action: the pharmacological profile of budipine. J Neural Transm Suppl. 1999;56:83-105.
3	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
4	Dose-dependent activation of distinct hypertrophic pathways by serotonin in cardiac cells. Am J Physiol Heart Circ Physiol. 2009 Aug;297(2):H821-8.
5	Limitation of adipose tissue enlargement in rats chronically treated with semicarbazide-sensitive amine oxidase and monoamine oxidase inhibitors. Pharmacol Res. 2008 Jun;57(6):426-34.
6	Glyceraldehyde-3-phosphate dehydrogenase-monoamine oxidase B-mediated cell death-induced by ethanol is prevented by rasagiline and 1-R-aminoindan. Neurotox Res. 2009 Aug;16(2):148-59.
7	Emerging drugs for epilepsy. Expert Opin Emerg Drugs. 2007 Sep;12(3):407-22.
8	2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85.
9	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2490).
10	Emerging drugs for Parkinson's disease. Expert Opin Emerg Drugs. 2006 Sep;11(3):403-17.
11	Novel monoamine oxidase inhibitors, 3-(2-aminoethoxy)-1,2-benzisoxazole derivatives, and their differential reversibility. Jpn J Pharmacol. 2002 Feb;88(2):174-82.
12	Rasagiline (TVP-1012): a new selective monoamine oxidase inhibitor for Parkinson's disease. Am J Geriatr Pharmacother. 2006 Dec;4(4):330-46.
13	Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80.
14	Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation. Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.
15	Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
16	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
17	Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
18	Clinical pipeline report, company report or official report of Oryzon Genomics Boston, MA
19	Sembragiline Alzheimer's Disease (Phase 2). Evotech AG, Roche.
20	Company report (Neurim Pharmaceuticals)
21	Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases. Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40.
22	Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42.
23	Novel monoamine oxidase inhibitors: a patent review (2012 - 2014).Expert Opin Ther Pat. 2015 Jan;25(1):91-110.
24	MAO inhibitors and their wider applications: a patent review.Expert Opin Ther Pat. 2018 Mar;28(3):211-226.
25	LSD1 inhibitors: a patent review (2010-2015).Expert Opin Ther Pat. 2016 May;26(5):565-80.
26	The activity of MAO A and B in rat renal cells and tubules. Life Sci. 1998;62(8):727-37.
27	A patent review of butyrylcholinesterase inhibitors and reactivators 2010-2017.Expert Opin Ther Pat. 2018 Jun;28(6):455-465.
28	mGlu5 negative allosteric modulators: a patent review (2013 - 2016).Expert Opin Ther Pat. 2017 Jun;27(6):691-706.
29	Structural and mechanistic studies of mofegiline inhibition of recombinant human monoamine oxidase B. J Med Chem. 2008 Dec 25;51(24):8019-26.
30	Assessment of MAO-B occupancy in the brain with PET and [11C]-L-deprenyl-D2: a dose-finding study with a novel MAO-B inhibitor, EVT 301. Clin Pharmacol Ther. 2009 May;85(5):506-12.
31	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020)
32	[(11)C]SL25.1188, a new reversible radioligand to study the monoamine oxidase type B with PET: preclinical characterisation in nonhuman primate. Synapse. 2010 Jan;64(1):61-9.
33	Milacemide, the selective substrate and enzyme-activated specific inhibitor of monoamine oxidase B, increases dopamine but not serotonin in caudate nucleus of rhesus monkey. Neurochem Int. 1990;17(2):325-9.
34	2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Feb 15;18(4):1388-95.
35	A new series of flavones, thioflavones, and flavanones as selective monoamine oxidase-B inhibitors. Bioorg Med Chem. 2010 Feb;18(3):1273-9.
36	Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors. Bioorg Med Chem. 2009 Mar 15;17(6):2452-60.
37	Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)ox... J Med Chem. 2009 Nov 12;52(21):6685-706.
38	Inhibition of monoamine oxidase by (E)-styrylisatin analogues. Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13.
39	Synthesis and in vitro evaluation of pteridine analogues as monoamine oxidase B and nitric oxide synthase inhibitors. Bioorg Med Chem. 2009 Nov 1;17(21):7523-30.
40	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
41	Docking studies on monoamine oxidase-B inhibitors: estimation of inhibition constants (K(i)) of a series of experimentally tested compounds. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4438-46.
42	Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoa... J Med Chem. 2007 Oct 4;50(20):4909-16.
43	3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A. J Med Chem. 2002 Mar 14;45(6):1180-3.
44	Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies. Bioorg Med Chem. 2007 Aug 1;15(15):5198-206.
45	Stereoisomers of allenic amines as inactivators of monoamine oxidase type B. Stereochemical probes of the active site. J Med Chem. 1988 Aug;31(8):1558-66.
46	Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.
47	Further explorations of unnatural alkaloids. J Nat Prod. 1985 Nov-Dec;48(6):878-93.
48	DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
49	Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9.
50	Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70.
51	3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor. J Med Chem. 2006 Sep 7;49(18):5578-86.
52	Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors. Bioorg Med Chem. 2010 Feb 15;18(4):1659-64.
53	Binding of an imidazopyridoindole at imidazoline I2 receptors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.
54	New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A ... Bioorg Med Chem. 2009 Jan 15;17(2):675-89.
55	Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives. J Med Chem. 2007 Nov 1;50(22):5364-71.
56	Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins. J Med Chem. 2009 Apr 9;52(7):1935-42.
57	Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxi... J Med Chem. 2004 Nov 18;47(24):5860-71.
58	Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors. J Med Chem. 2008 Nov 13;51(21):6740-51.
59	Inhibition of monoamine oxidase by indole and benzofuran derivatives. Eur J Med Chem. 2010 Oct;45(10):4458-66.
60	New halogenated 3-phenylcoumarins as potent and selective MAO-B inhibitors. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5157-60.
61	Synthesis and evaluation of 6-methyl-3-phenylcoumarins as potent and selective MAO-B inhibitors. Bioorg Med Chem Lett. 2009 Sep 1;19(17):5053-5.
62	Multiple, small dose administration of (-)deprenyl enhances catecholaminergic activity and diminishes serotoninergic activity in the brain and these effects are unrelated to MAO-B inhibition. Arch Int Pharmacodyn Ther. 1994 Jul-Aug;328(1):1-15.
63	Chromone-2- and -3-carboxylic acids inhibit differently monoamine oxidases A and B. Bioorg Med Chem Lett. 2010 May 1;20(9):2709-12.
64	Identification of novel monoamine oxidase B inhibitors by structure-based virtual screening. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5295-8.
65	Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs. J Med Chem. 2007 Nov 15;50(23):5848-52.
66	Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues. Bioorg Med Chem. 2010 Feb;18(3):1018-28.
67	Simple, potent, and selective pyrrole inhibitors of monoamine oxidase types A and B. J Med Chem. 2003 Mar 13;46(6):917-20.
68	Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
69	Aliphatic propargylamines: potent, selective, irreversible monoamine oxidase B inhibitors. J Med Chem. 1992 Oct 2;35(20):3705-13.
70	Chalcones: a valid scaffold for monoamine oxidases inhibitors. J Med Chem. 2009 May 14;52(9):2818-24.
71	Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases... Bioorg Med Chem. 2008 Aug 1;16(15):7148-66.
72	The effect of deprenyl washout in patients with long-standing Parkinson's disease. J Neural Transm. 2002 May;109(5-6):797-803.
73	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
74	Inhibition of monoamine oxidase type A, but not type B, is an effective means of inducing anticonvulsant activity in the kindling model of epilepsy. J Pharmacol Exp Ther. 1999 Mar;288(3):984-92.
75	Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B. Bioorg Med Chem. 2008 Nov 15;16(22):9729-40.
76	New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. J Med Chem. 2007 Mar 8;50(5):922-31.
77	Monoamine oxidases (MAO) in the pathogenesis of heart failure and ischemia/reperfusion injury. Biochim Biophys Acta. 2011 Jul;1813(7):1323-32.