Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTPTXIN)

• DTT Name: Translocator protein (TSPO)
• Synonyms: Peripheral-type benzodiazepine receptor; Peripheral benzodiazepine receptor; PKBS; PBR; Mitochondrial benzodiazepine receptor; MBR; BZRP
• Gene Name: TSPO
• DTT Type: Successful target; [1]
• Related Disease:
  Anxiety disorder [ICD-11: 6B00-6B0Z]
  Epilepsy/seizure [ICD-11: 8A61-8A6Z]
  Insomnia [ICD-11: 7A00-7A0Z]
  Intentional self-harm [ICD-11: PC91]
  Mood/affect symptom [ICD-11: MB24]
  Tonus and reflex abnormality [ICD-11: MB47]
• BioChemical Class: Cholesterol/porphyrin uptake translocator
• UniProt ID: TSPO_HUMAN
• TTD ID: T75440
• Sequence:
  MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
  GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
  ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
• Function: Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme.
• Reactome Pathway: Pregnenolone biosynthesis (R-HSA-196108)

Molecular Interaction Atlas (MIA) of This DTT

23 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Adinazolam	DMBHO9Y	Anxiety disorder	6B00-6B0Z	Approved	[2]
Alpidem	DMN7Y9K	Anxiety disorder	6B00-6B0Z	Approved	[3]
Alprazolam	DMC7XDN	Anxiety disorder	6B00-6B0Z	Approved	[1], [4]
Chlordiazepoxide	DMTN5XI	Anxiety disorder	6B00-6B0Z	Approved	[5]
Chlormezanone	DMTWUXR	Anxiety disorder	6B00-6B0Z	Approved	[6]
Cinolazepam	DMDX1ZC	Muscle spasm	MB47.3	Approved	[7]
Clorazepate	DMC3JST	Anxiety disorder	6B00-6B0Z	Approved	[5]
Clotiazepam	DM59AZT	Anxiety disorder	6B00-6B0Z	Approved	[8]
Diazepam	DM08E9O	Epilepsy	8A60-8A68	Approved	[9], [10]
Estazolam	DMZGXUM	Insomnia	7A00-7A0Z	Approved	[11], [12]
Eszopiclone	DM8RZ9H	Insomnia	7A00-7A0Z	Approved	[13], [4]
Fludiazepam	DMD2K4I	Anxiety disorder	6B00-6B0Z	Approved	[14]
Flumazenil	DMPCG2L	Benzodiazepine overdose	PC91	Approved	[15]
Flunitrazepam	DMGR5Z3	Insomnia	7A00-7A0Z	Approved	[1]
Flurazepam	DMAL4G0	Insomnia	7A00-7A0Z	Approved	[5]
Halazepam	DMPFWO6	Anxiety disorder	6B00-6B0Z	Approved	[5]
Lorazepam	DM84ZXF	Anxiety disorder	6B00-6B0Z	Approved	[5]
Midazolam	DMXOELT	Irritability	MB24	Approved	[5]
Oxazepam	DMXNZM4	Anxiety disorder	6B00-6B0Z	Approved	[16]
Prazepam	DMEWC7N	Anxiety disorder	6B00-6B0Z	Approved	[5]
Quazepam	DMY4D87	Insomnia	7A00-7A0Z	Approved	[5]
Temazepam	DM02A65	Insomnia	7A00-7A0Z	Approved	[5]
Triazolam	DMETYK5	Insomnia	7A00-7A0Z	Approved	[5]

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
11C-PBR-28	DMSLMY7	Brain disease	8C70-8E61	Phase 2	[17]
Dextofisopam	DM9L15R	Irritable bowel syndrome	DD91.0	Phase 2	[18]
ONO-2952	DMOGYQ0	Irritable bowel syndrome	DD91.0	Phase 2	[19]
SSR-180575	DMA0QZH	Rheumatoid arthritis	FA20	Phase 2	[20], [21]
TLN-4601	DMVXLQ7	Solid tumour/cancer	2A00-2F9Z	Phase 2	[22]
18F-FEDAA-1106	DMZ5YMX	Alzheimer disease	8A20	Phase 1	[23]
BAY-85-8102	DMOUVE7	Brain disease	8C70-8E61	Phase 1	[15]

93 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aryl oxyanilide derivative 1	DML1IXV	N. A.	N. A.	Patented	[24]
Aryl oxyanilide derivative 2	DM47V3I	N. A.	N. A.	Patented	[24]
Aryl oxyanilide derivative 3	DMSGO7D	N. A.	N. A.	Patented	[24]
Benzimidazolone acetamide derivative 1	DMRZELF	N. A.	N. A.	Patented	[24]
Benzimidazolone acetamide derivative 2	DMD9VC1	N. A.	N. A.	Patented	[24]
Benzodiazepine derivative 1	DMFXC5L	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 1	DM9FPK1	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 2	DMZ3NSJ	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 3	DM24NZG	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 4	DMV4OTD	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 5	DMCH1WX	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 6	DMB5KLD	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 7	DM25ZY4	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 8	DMAXDV5	N. A.	N. A.	Patented	[24]
Benzothiazepine analog 9	DMONDMG	N. A.	N. A.	Patented	[24]
Benzoxazepine analog 1	DMIYXS8	N. A.	N. A.	Patented	[24]
Bidentate pyrazolopyrimidine acetamide analog 1	DMPWKAH	N. A.	N. A.	Patented	[24]
Bidentate pyrazolopyrimidine acetamide analog 2	DM6SPTJ	N. A.	N. A.	Patented	[24]
Bidentate pyrazolopyrimidine acetamide analog 3	DMC7UHT	N. A.	N. A.	Patented	[24]
Bidentate pyrazolopyrimidine acetamide analog 4	DMKZLCQ	N. A.	N. A.	Patented	[24]
Imidazopyridine acetamide analog 1	DMO41ZB	N. A.	N. A.	Patented	[24]
Imidazopyridine acetamide analog 2	DMIKMBO	N. A.	N. A.	Patented	[24]
Imidazopyridine acetamide analog 3	DMZ08LD	N. A.	N. A.	Patented	[24]
Imidazopyridine acetamide analog 4	DMPHK87	N. A.	N. A.	Patented	[24]
Imidazopyridine acetamide analog 5	DMMFCRU	N. A.	N. A.	Patented	[24]
Imidazopyridine acetamide analog 6	DME7M5R	N. A.	N. A.	Patented	[24]
Imidazopyridine acetamide analog 7	DMQDA3I	N. A.	N. A.	Patented	[24]
Imidazopyridine derivative 1	DM8EB57	N. A.	N. A.	Patented	[24]
Imidazopyridine derivative 2	DM9FRV7	N. A.	N. A.	Patented	[24]
Imidazo[1,2-b]pyridazine acetamide derivative 1	DM654Z0	N. A.	N. A.	Patented	[24]
Imidazo[1,2-b]pyridazine acetamide derivative 2	DMVX7YB	N. A.	N. A.	Patented	[24]
Imidazo[1,2-b]pyridazine acetamide derivative 3	DMARLZ6	N. A.	N. A.	Patented	[24]
Imidazo[1,2-b]pyridazine acetamide derivative 4	DM5J09E	N. A.	N. A.	Patented	[24]
Imidazo[1,2-b]pyridazine acetamide derivative 5	DMGWYJR	N. A.	N. A.	Patented	[24]
Imidazo[1,2-b]pyridazine acetamide derivative 6	DM73ESA	N. A.	N. A.	Patented	[24]
Imidazo[1,2-b]pyridazine acetamide derivative 7	DMQLJU2	N. A.	N. A.	Patented	[24]
Indole-based analog 10	DMAM6YC	N. A.	N. A.	Patented	[25]
Indole-based analog 5	DM5JUR2	N. A.	N. A.	Patented	[25]
Indole-based analog 9	DMFI2H6	N. A.	N. A.	Patented	[25]
Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 1	DMI3YO7	N. A.	N. A.	Patented	[24]
Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 2	DM8LNXQ	N. A.	N. A.	Patented	[24]
Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 3	DM39H1F	N. A.	N. A.	Patented	[24]
Isoquinoline carboxamide derivative 1	DMOAY3Q	N. A.	N. A.	Patented	[24]
Phenylpurine acetamide analog 1	DMLSWKR	N. A.	N. A.	Patented	[24]
Phenylpurine acetamide analog 2	DMMGBLC	N. A.	N. A.	Patented	[24]
PMID27599163-Compound-52	DM5KARO	N. A.	N. A.	Patented	[25]
PMID27599163-Compound-75	DMYCQR4	N. A.	N. A.	Patented	[25]
PMID27599163-Compound-76	DMODPFU	N. A.	N. A.	Patented	[25]
PMID27599163-Compound-77	DM2TNH4	N. A.	N. A.	Patented	[25]
PMID27599163-Compound-78	DMZC58R	N. A.	N. A.	Patented	[25]
PMID27599163-Compound-79	DMVUWYB	N. A.	N. A.	Patented	[25]
PMID27599163-Compound-81	DMZ5QC4	N. A.	N. A.	Patented	[25]
PMID27599163-Compound-82	DMO74I9	N. A.	N. A.	Patented	[25]
PMID27607364-Compound-10	DM5RBFC	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-141	DMMF4XO	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-162	DM0F6VU	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-4	DMKBZDP	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-58	DMXJVW4	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-59	DMLY7I3	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-60	DM584EP	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-61	DMWE6NZ	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-62	DMXGT2A	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-63	DMVTPHY	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-64	DMZSI15	N. A.	N. A.	Patented	[24]
PMID27607364-Compound-65	DM9NEFG	N. A.	N. A.	Patented	[24]
Pyrazolopyrimidine acetamide analog 1	DMRAS8L	N. A.	N. A.	Patented	[24]
Pyrazolopyrimidine acetamide analog 2	DMK7F3A	N. A.	N. A.	Patented	[24]
Quinazoline derivative 2	DMGECO2	N. A.	N. A.	Patented	[24]
Quinazoline derivative 3	DMF05GL	N. A.	N. A.	Patented	[24]
Quinazoline derivative 4	DMJIDLU	N. A.	N. A.	Patented	[24]
Quinazoline derivative 5	DMEIH73	N. A.	N. A.	Patented	[24]
Quinazoline derivative 6	DMKZ6MD	N. A.	N. A.	Patented	[24]
Quinazoline derivative 7	DMIBRE5	N. A.	N. A.	Patented	[24]
Quinoline carboxamide derivative 10	DMZTQVF	N. A.	N. A.	Patented	[24]
Quinoline carboxamide derivative 4	DMVUNYD	N. A.	N. A.	Patented	[24]
Quinoline carboxamide derivative 5	DM14029	N. A.	N. A.	Patented	[24]
Quinoline carboxamide derivative 6	DMQ9ATN	N. A.	N. A.	Patented	[24]
Quinoline carboxamide derivative 7	DM8AG0Z	N. A.	N. A.	Patented	[24]
Quinoline carboxamide derivative 8	DM3IXYL	N. A.	N. A.	Patented	[24]
Quinoline carboxamide derivative 9	DM7YFBT	N. A.	N. A.	Patented	[24]
Tricyclic indole compound 1	DM4HBWU	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 10	DMK1QTH	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 11	DML724H	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 12	DMEZQ29	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 14	DMXVNSR	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 2	DMHRY63	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 3	DM5B92W	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 4	DMUZ4L3	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 5	DMX5YG9	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 6	DMXAS8P	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 7	DMFQSU8	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 8	DMYAUVM	N. A.	N. A.	Patented	[25]
Tricyclic indole compound 9	DMVA7BC	N. A.	N. A.	Patented	[25]

11 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ro-16-6028	DM8M1X0	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[26]
Emapunil	DM0RXCK	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[27]
Lirequinil	DM5ENKG	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[28]
S-8510	DM9BEDL	Cognitive impairment	6D71	Discontinued in Phase 2	[21]
TRO-40303	DMZ98Y4	Lateral sclerosis	8B61	Discontinued in Phase 2	[29]
Imepitoin	DM8OYZB	Convulsion	8A68.Z	Discontinued in Phase 1	[30]
DAA-1097	DM3LJK5	Anxiety disorder	6B00-6B0Z	Terminated	[31]
Ginkgolide B (GKB)	DMX0N9P	N. A.	N. A.	Terminated	[32]
Miltirone	DMZNWAV	Anxiety disorder	6B00-6B0Z	Terminated	[33]
NNC-13-8119	DMMOAN0	Anxiety disorder	6B00-6B0Z	Terminated	[34]
NS-2979	DM19OGY	Pain	MG30-MG3Z	Terminated	[35]

17 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(R)PK-11195	DM03N5V	Discovery agent	N.A.	Investigative	[36]
11C-PBR-170	DMYGE3K	Discovery agent	N.A.	Investigative	[15]
2-(2-Phenyl-1H-indol-3-yl)-N,N-dipropyl-acetamide	DM1K0U5	Discovery agent	N.A.	Investigative	[37]
4-Methoxy-5-phenyl-6-thia-10b-aza-benzo[e]azulene	DMID40H	Discovery agent	N.A.	Investigative	[38]
5-Phenyl-6-thia-10b-aza-benzo[e]azulen-4-one	DMLK2VT	Discovery agent	N.A.	Investigative	[39]
5-Phenyl-6-thia-10b-aza-benzo[e]azulene	DMUBCVL	Discovery agent	N.A.	Investigative	[38]
6-Thia-10b-aza-benzo[e]azulen-4-one	DMVGC7H	Discovery agent	N.A.	Investigative	[39]
Benzodiazepine	DM9H34M	Anxiety disorder	6B00-6B0Z	Investigative	[15]
FGIN-1-27	DM4T5DY	Discovery agent	N.A.	Investigative	[40]
N,N-Diethyl-2-(2-phenyl-1H-indol-3-yl)-acetamide	DMBFASY	Discovery agent	N.A.	Investigative	[37]
N,N-Dihexyl-2-(2-phenyl-1H-indol-3-yl)-acetamide	DMV8QTR	Discovery agent	N.A.	Investigative	[37]
N,N-Dimethyl-2-(2-phenyl-1H-indol-3-yl)-acetamide	DM73PXI	Discovery agent	N.A.	Investigative	[37]
N-Hexyl-2-(2-phenyl-1H-indol-3-yl)-acetamide	DMM0F2G	Discovery agent	N.A.	Investigative	[37]
PK 11195	DMDOZPU	Discovery agent	N.A.	Investigative	[40]
Ro 5-4864	DMTQP0K	Gram-positive bacterial infection	1B74-1G40	Investigative	[40], [41]
TGSC01AA(4)	DM1BVW3	Anxiety disorder	6B00-6B0Z	Investigative	[15]
U-89854	DMI6VAX	Anxiety disorder	6B00-6B0Z	Investigative	[15]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rheumatoid arthritis	FA20	Synovial tissue	2.65E-05	1.98	4.26
Irritable bowel syndrome	DD91.0	Rectal colon tissue	1.60E-01	-0.64	-0.84
Alzheimer's disease	8A00.0	Entorhinal cortex	3.93E-10	0.43	1.02
Lateral sclerosis	8A00.0	Cervical spinal cord	7.49E-01	-0.14	-0.32

References

• [1] Comparison of five benzodiazepine-receptor agonists on buprenorphine-induced mu-opioid receptor regulation. J Pharmacol Sci. 2009 May;110(1):36-46.
• [2] Effects of antidepressants and benzodiazepine treatments on the dendritic structure of CA3 pyramidal neurons after chronic stress. Eur J Pharmacol. 1999 Apr 29;371(2-3):113-22.
• [3] Anxiolytic-like effects of N,N-dialkyl-2-phenylindol-3-ylglyoxylamides by modulation of translocator protein promoting neurosteroid biosynthesis. J Med Chem. 2008 Sep 25;51(18):5798-806.
• [4] Glutamate- and GABA-based CNS therapeutics. Curr Opin Pharmacol. 2006 Feb;6(1):7-17.
• [5] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [6] Successful treatment of anxiety with a single night-time dose of chlormezanone: double-blind comparison with diazepam. Curr Med Res Opin. 1982;8(1):33-8.
• [7] Short-term sleep laboratory studies with cinolazepam in situational insomnia induced by traffic noise. Int J Clin Pharmacol Res. 1987;7(5):407-18.
• [8] Effects of benzodiazepines and non-benzodiazepine compounds on the GABA-induced response in frog isolated sensory neurones. Br J Pharmacol. 1989 Nov;98(3):735-40.
• [9] Translocator protein (18 kDa) mediates the pro-growth effects of diazepam on Ehrlich tumor cells in vivo. Eur J Pharmacol. 2010 Jan 25;626(2-3):131-8.
• [10] The alpha5(H105R) mutation impairs alpha5 selective binding properties by altered positioning of the alpha5 subunit in GABAA receptors containing t... J Neurochem. 2009 Jul;110(1):244-54.
• [11] Design and synthesis of new 2-substituted-5-(2-benzylthiophenyl)-1,3,4-oxadiazoles as benzodiazepine receptor agonists. Bioorg Med Chem Lett. 2005 Jun 15;15(12):3126-9.
• [12] Design and synthesis of 4H-3-(2-phenoxy)phenyl-1,2,4-triazole derivatives as benzodiazepine receptor agonists. Bioorg Med Chem. 2003 Mar 6;11(5):769-73.
• [13] New hypnotics: perspectives from sleep physiology. Vertex. 2007 Jul-Aug;18(74):294-9.
• [14] Benzodiazepines and their metabolites: relationship between binding affinity to the benzodiazepine receptor and pharmacological activity. Life Sci. 1985 Jan 14;36(2):113-9.
• [15] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2879).
• [16] Effects of the combination of metyrapone and oxazepam on cocaine and food self-administration in rats. Pharmacol Biochem Behav. 2008 Nov;91(1):181-9.
• [17] PET imaging with [11C]PBR28 can localize and quantify upregulated peripheral benzodiazepine receptors associated with cerebral ischemia in rat. Neurosci Lett. 2007 Jan 16;411(3):200-5.
• [18] Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313.
• [19] Anti-stress effects of ONO-2952, a novel translocator protein 18 kDa antagonist, in rats. Neuropharmacology. 2015 Jul 17;99:51-66.
• [20] SSR180575 (7-chloro-N,N,5-trimethyl-4-oxo-3-phenyl-3,5-dihydro-4H-pyridazino[4,5-b]indole-1-acetamide), a peripheral benzodiazepine receptor ligand, promotes neuronal survival and repair. J PharmacolExp Ther. 2002 Jun;301(3):1067-78.
• [21] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [22] TLN-4601 peripheral benzodiazepine receptor (PBR/TSPO) binding properties do not mediate apoptosis but confer tumor-specific accumulation.Biochem Pharmacol.2010 Nov 15;80(10):1572-9.
• [23] Role of peripheral benzodiazepine receptors in mitochondrial, cellular, and cardiac damage induced by oxidative stress and ischemia-reperfusion. J Pharmacol Exp Ther. 2003 Sep;306(3):828-37.
• [24] Translocator protein (TSPO) ligands for the diagnosis or treatment of neurodegenerative diseases: a patent review (2010-2015; part 1).Expert Opin Ther Pat. 2016 Nov;26(11):1325-1351.
• [25] Translocator protein (TSPO) ligands for the diagnosis or treatment of neurodegenerative diseases: a patent review (2010 - 2015; part 2).Expert Opin Ther Pat. 2016 Nov;26(11):1353-1366.
• [26] Bretazenil, a benzodiazepine receptor partial agonist, as an adjunct in the prophylactic treatment of OP poisoning. J Appl Toxicol. 2001 Dec;21 Suppl 1:S115-9.
• [27] Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
• [28] Pharmacokinetics and pharmacodynamics of Ro 41-3696, a novel nonbenzodiazepine hypnotic. J Clin Pharmacol. 1995 Aug;35(8):821-9.
• [29] Translation of TRO40303 from myocardial infarction models to demonstration of safety and tolerance in a randomized Phase I trial. J Transl Med. 2014; 12: 38.
• [30] The pharmacology of imepitoin: the first partial benzodiazepine receptor agonist developed for the treatment of epilepsy. CNS Drugs. 2014 Jan;28(1):29-43.
• [31] Neuropharmacological profile of peripheral benzodiazepine receptor agonists, DAA1097 and DAA1106. Life Sci. 1999;64(16):1455-64.
• [32] Drug-induced inhibition of the peripheral-type benzodiazepine receptor expression and cell proliferation in human breast cancer cells. Anticancer Res. 2000 Sep-Oct;20(5A):2835-47.
• [33] Miltirone, a central benzodiazepine receptor partial agonist from a Chinese medicinal herb Salvia miltiorrhiza. Neurosci Lett. 1991 Jun 24;127(2):237-41.
• [34] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004060)
• [35] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013494)
• [36] [18F]FMDAA1106 and [18F]FEDAA1106: two positron-emitter labeled ligands for peripheral benzodiazepine receptor (PBR). Bioorg Med Chem Lett. 2003 Jan 20;13(2):201-4.
• [37] Chemistry, binding affinities, and behavioral properties of a new class of "antineophobic" mitochondrial DBI receptor complex (mDRC) ligands. J Med Chem. 1993 Oct 1;36(20):2908-20.
• [38] A concerted study using binding measurements, X-ray structural data, and molecular modeling on the stereochemical features responsible for the affi... J Med Chem. 1995 Nov 10;38(23):4730-8.
• [39] Novel ligands specific for mitochondrial benzodiazepine receptors: 6-arylpyrrolo[2,1-d][1,5]benzothiazepine derivatives. Synthesis, structure-activ... J Med Chem. 1994 May 13;37(10):1427-38.
• [40] Specific ligands of the peripheral benzodiazepine receptor induce apoptosis and cell cycle arrest in human colorectal cancer cells. Br J Cancer. 2001 Nov 30;85(11):1771-80.
• [41] Antiproliferative and differentiating effects of benzodiazepine receptor ligands on B16 melanoma cells. Biochem Pharmacol. 1998 Oct 15;56(8):1029-34.