Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT02B8IR)

• DOT Name: Selenoprotein P (SELENOP)
• Synonyms: SeP
• Gene Name: SELENOP
• Related Disease:
  Carcinoma
  Coronary heart disease
  Hyperglycemia
  Lung cancer
  Non-small-cell lung cancer
  Undifferentiated carcinoma
  Abdominal aortic aneurysm
  Adenoma
  Alzheimer disease
  Breast cancer
  Breast carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal adenoma
  Fatty liver disease
  Hepatocellular carcinoma
  Metabolic disorder
  Myocardial infarction
  Neoplasm
  Non-alcoholic fatty liver disease
  Parkinson disease
  Peripheral arterial disease
  Prostate cancer
  Schizophrenia
  Stroke
  Cardiovascular disease
  Neurodegenerative disease
  Non-insulin dependent diabetes
  Endometriosis
  Inflammatory bowel disease
  Lung adenocarcinoma
  Lung carcinoma
  Advanced cancer
  Colorectal carcinoma
  Colorectal neoplasm
  Hepatitis C virus infection
  Liver cancer
  Liver cirrhosis
  Lung neoplasm
  Male infertility
  Nervous system disease
  Obesity
  Prostate carcinoma
  Prostate neoplasm
  Type-1/2 diabetes
• UniProt ID: SEPP1_HUMAN
• Pfam ID: PF04593 ; PF04592
• Sequence:
  MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUY
  LCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQ
  TDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTL
  KDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAP
  PGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSU
  CCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPAAUQISQQLIP
  TEASASURUKNQAKKUEUPSN
• Function: Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.
• Tissue Specificity: Made in the liver and heart and secreted into the plasma. It is also found in the kidney.
• Reactome Pathway: Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Definitive	Biomarker	[1]
Coronary heart disease	DIS5OIP1	Definitive	Altered Expression	[2]
Hyperglycemia	DIS0BZB5	Definitive	Biomarker	[3]
Lung cancer	DISCM4YA	Definitive	Biomarker	[4]
Non-small-cell lung cancer	DIS5Y6R9	Definitive	Altered Expression	[5]
Undifferentiated carcinoma	DISIAZST	Definitive	Biomarker	[1]
Abdominal aortic aneurysm	DISD06OF	Strong	Genetic Variation	[6]
Adenoma	DIS78ZEV	Strong	Biomarker	[7]
Alzheimer disease	DISF8S70	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[10]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Colorectal adenoma	DISTSVHM	Strong	Genetic Variation	[7]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[14]
Myocardial infarction	DIS655KI	Strong	Biomarker	[15]
Neoplasm	DISZKGEW	Strong	Biomarker	[16]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[13]
Parkinson disease	DISQVHKL	Strong	Altered Expression	[17]
Peripheral arterial disease	DIS78WFB	Strong	Genetic Variation	[6]
Prostate cancer	DISF190Y	Strong	Altered Expression	[18]
Schizophrenia	DISSRV2N	Strong	Biomarker	[19]
Stroke	DISX6UHX	Strong	Biomarker	[20]
Cardiovascular disease	DIS2IQDX	moderate	Altered Expression	[21]
Neurodegenerative disease	DISM20FF	moderate	Biomarker	[22]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Altered Expression	[23]
Endometriosis	DISX1AG8	Disputed	Biomarker	[24]
Inflammatory bowel disease	DISGN23E	Disputed	Biomarker	[25]
Lung adenocarcinoma	DISD51WR	Disputed	Biomarker	[4]
Lung carcinoma	DISTR26C	Disputed	Biomarker	[4]
Advanced cancer	DISAT1Z9	Limited	Genetic Variation	[26]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[27]
Colorectal neoplasm	DISR1UCN	Limited	Biomarker	[7]
Hepatitis C virus infection	DISQ0M8R	Limited	Altered Expression	[28]
Liver cancer	DISDE4BI	Limited	Biomarker	[29]
Liver cirrhosis	DIS4G1GX	Limited	Biomarker	[13]
Lung neoplasm	DISVARNB	Limited	Biomarker	[5]
Male infertility	DISY3YZZ	Limited	Biomarker	[30]
Nervous system disease	DISJ7GGT	Limited	Biomarker	[30]
Obesity	DIS47Y1K	Limited	Biomarker	[31]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[18]
Prostate neoplasm	DISHDKGQ	Limited	Biomarker	[32]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[33]

32 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Selenoprotein P (SELENOP).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Selenoprotein P (SELENOP).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Selenoprotein P (SELENOP).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Selenoprotein P (SELENOP).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Selenoprotein P (SELENOP).	[38]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Selenoprotein P (SELENOP).	[39]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Selenoprotein P (SELENOP).	[40]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Selenoprotein P (SELENOP).	[41]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Selenoprotein P (SELENOP).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Selenoprotein P (SELENOP).	[43]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Selenoprotein P (SELENOP).	[44]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Selenoprotein P (SELENOP).	[45]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Selenoprotein P (SELENOP).	[46]
Marinol	DM70IK5	Approved	Marinol increases the expression of Selenoprotein P (SELENOP).	[47]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Selenoprotein P (SELENOP).	[48]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Selenoprotein P (SELENOP).	[41]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Selenoprotein P (SELENOP).	[43]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Selenoprotein P (SELENOP).	[49]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Selenoprotein P (SELENOP).	[50]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Selenoprotein P (SELENOP).	[51]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Selenoprotein P (SELENOP).	[52]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of Selenoprotein P (SELENOP).	[53]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Selenoprotein P (SELENOP).	[54]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Selenoprotein P (SELENOP).	[43]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Selenoprotein P (SELENOP).	[55]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Selenoprotein P (SELENOP).	[57]
Wortmannin	DM8EVK5	Terminated	Wortmannin increases the expression of Selenoprotein P (SELENOP).	[58]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Selenoprotein P (SELENOP).	[59]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Selenoprotein P (SELENOP).	[60]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Selenoprotein P (SELENOP).	[39]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Selenoprotein P (SELENOP).	[61]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Selenoprotein P (SELENOP).	[62]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Selenoprotein P (SELENOP).	[56]

References

• [1] Global gene expression profiling of chemically induced rat mammary gland carcinomas and adenomas.Toxicol Pathol. 2005;33(7):768-75. doi: 10.1080/01926230500437027.
• [2] Effects of selenium supplementation on expression of SEPP1 in mRNA and protein levels in subjects with and without metabolic syndrome suffering from coronary artery disease: Selenegene study a double-blind randomized controlled trial.J Cell Biochem. 2018 Nov;119(10):8282-8289. doi: 10.1002/jcb.26844. Epub 2018 Jun 22.
• [3] Circulating Concentrations of Insulin Resistance-Associated Hepatokines, Selenoprotein P and Leukocyte Cell-Derived Chemotaxin 2, during an Oral Glucose Tolerance Test in Humans.Biol Pharm Bull. 2019 Mar 1;42(3):373-378. doi: 10.1248/bpb.b18-00549. Epub 2018 Dec 28.
• [4] Plasma selenoprotein P concentration and lung cancer risk: results from a case-control study nested within the Shanghai Men's Health Study.Carcinogenesis. 2018 Dec 13;39(11):1352-1358. doi: 10.1093/carcin/bgy103.
• [5] Expression of selenoprotein-coding genes SEPP1, SEP15 and hGPX1 in non-small cell lung cancer.Lung Cancer. 2009 Jul;65(1):34-40. doi: 10.1016/j.lungcan.2008.10.023. Epub 2008 Dec 6.
• [6] Associations and interactions between variants in selenoprotein genes, selenoprotein levels and the development of abdominal aortic aneurysm, peripheral arterial disease, and heart failure.PLoS One. 2018 Sep 6;13(9):e0203350. doi: 10.1371/journal.pone.0203350. eCollection 2018.
• [7] Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma.Cancer Epidemiol Biomarkers Prev. 2008 May;17(5):1144-54. doi: 10.1158/1055-9965.EPI-07-2947.
• [8] Selenoprotein P and its potential role in Alzheimer's disease.Hormones (Athens). 2020 Mar;19(1):73-79. doi: 10.1007/s42000-019-00112-w. Epub 2019 Jun 27.
• [9] Socioeconomic and demographic disparities in breast cancer stage at presentation and survival: A Swiss population-based study.Int J Cancer. 2017 Oct 15;141(8):1529-1539. doi: 10.1002/ijc.30856. Epub 2017 Jul 7.
• [10] Selenium levels in human breast carcinoma tissue are associated with a common polymorphism in the gene for SELENOP (Selenoprotein P).J Trace Elem Med Biol. 2017 Jan;39:227-233. doi: 10.1016/j.jtemb.2016.11.003. Epub 2016 Nov 11.
• [11] Proinflammatory cytokines down-regulate intestinal selenoprotein P biosynthesis via NOS2 induction.Free Radic Biol Med. 2010 Sep 1;49(5):777-85. doi: 10.1016/j.freeradbiomed.2010.05.035. Epub 2010 Jun 9.
• [12] Selenoprotein P in Patients with Nonalcoholic Fatty Liver Disease.Exp Clin Endocrinol Diabetes. 2019 Oct;127(9):598-602. doi: 10.1055/a-0811-9136. Epub 2019 Jan 9.
• [13] Selenium and selenoprotein P in nonalcoholic fatty liver disease.Hormones (Athens). 2020 Mar;19(1):61-72. doi: 10.1007/s42000-019-00127-3. Epub 2019 Sep 6.
• [14] Metabolomics signature associated with circulating serum selenoprotein P levels.Endocrine. 2019 Jun;64(3):486-495. doi: 10.1007/s12020-018-1816-9. Epub 2018 Nov 17.
• [15] Selenoprotein P in Myocardial Infarction With Cardiogenic Shock.Shock. 2020 Jan;53(1):58-62. doi: 10.1097/SHK.0000000000001342.
• [16] Combined SEP and anti-PD-L1 antibody produces a synergistic antitumor effect in B16-F10 melanoma-bearing mice.Sci Rep. 2018 Jan 9;8(1):217. doi: 10.1038/s41598-017-18641-y.
• [17] Selenium speciation analysis in the cerebrospinal fluid of patients with Parkinson's disease.J Trace Elem Med Biol. 2020 Jan;57:126412. doi: 10.1016/j.jtemb.2019.126412. Epub 2019 Sep 24.
• [18] Interaction of NKX3.1 and SELENOP genotype with prostate cancer recurrence.Prostate. 2019 Apr;79(5):462-467. doi: 10.1002/pros.23752. Epub 2018 Dec 23.
• [19] SEP-363856, a Novel Psychotropic Agent with a Unique, Non-D(2) Receptor Mechanism of Action.J Pharmacol Exp Ther. 2019 Oct;371(1):1-14. doi: 10.1124/jpet.119.260281. Epub 2019 Aug 1.
• [20] Bedside neurophysiological tests can identify neonates with stroke leading to cerebral palsy.Clin Neurophysiol. 2019 May;130(5):759-766. doi: 10.1016/j.clinph.2019.02.017. Epub 2019 Mar 15.
• [21] Effect of single nucleotide polymorphisms in SEPS1 and SEPP1 on expression in the protein level in metabolic syndrome in subjects with cardiovascular disease.Mol Biol Rep. 2019 Dec;46(6):5685-5693. doi: 10.1007/s11033-019-05000-5. Epub 2019 Sep 21.
• [22] Neurodegeneration in mice resulting from loss of functional selenoprotein P or its receptor apolipoprotein E receptor 2.J Neuropathol Exp Neurol. 2008 Jan;67(1):68-77. doi: 10.1097/NEN.0b013e318160f347.
• [23] Selenium Levels in Community Dwellers with Type 2 Diabetes Mellitus.Biol Trace Elem Res. 2019 Oct;191(2):354-362. doi: 10.1007/s12011-019-1645-6. Epub 2019 Feb 6.
• [24] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [25] Roles for selenium and selenoprotein P in the development, progression, and prevention of intestinal disease.Free Radic Biol Med. 2018 Nov 1;127:26-35. doi: 10.1016/j.freeradbiomed.2018.05.066. Epub 2018 May 17.
• [26] Lipid peroxidation and glutathione peroxidase activity relationship in breast cancer depends on functional polymorphism of GPX1.BMC Cancer. 2015 Oct 7;15:657. doi: 10.1186/s12885-015-1680-4.
• [27] Genetic variants in selenoprotein genes increase risk of colorectal cancer.Carcinogenesis. 2010 Jun;31(6):1074-9. doi: 10.1093/carcin/bgq076. Epub 2010 Apr 8.
• [28] Induction of Selenoprotein P mRNA during Hepatitis C Virus Infection Inhibits RIG-I-Mediated Antiviral Immunity.Cell Host Microbe. 2019 Apr 10;25(4):588-601.e7. doi: 10.1016/j.chom.2019.02.015.
• [29] Enhanced antitumor activity of gemcitabine by polysaccharide-induced NK cell activation and immune cytotoxicity reduction in vitro/vivo.Carbohydr Polym. 2017 Oct 1;173:360-371. doi: 10.1016/j.carbpol.2017.06.024. Epub 2017 Jun 10.
• [30] Hepatic selenoprotein P (SePP) expression restores selenium transport and prevents infertility and motor-incoordination in Sepp-knockout mice.Biochem J. 2008 Feb 1;409(3):741-9. doi: 10.1042/BJ20071172.
• [31] Relationship between Selenium and Hematological Markers in Young Adults with Normal Weight or Overweight/Obesity.Antioxidants (Basel). 2019 Oct 8;8(10):463. doi: 10.3390/antiox8100463.
• [32] Interaction between single nucleotide polymorphisms in selenoprotein P and mitochondrial superoxide dismutase determines prostate cancer risk.Cancer Res. 2008 Dec 15;68(24):10171-7. doi: 10.1158/0008-5472.CAN-08-1827.
• [33] Dietary pattern associated with selenoprotein P and MRI-derived body fat volumes, liver signal intensity, and metabolic disorders.Eur J Nutr. 2019 Apr;58(3):1067-1079. doi: 10.1007/s00394-018-1624-2. Epub 2018 Feb 14.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Gene expression data from acetaminophen-induced toxicity in human hepatic in vitro systems and clinical liver samples. Data Brief. 2016 Mar 26;7:1052-1057. doi: 10.1016/j.dib.2016.03.069. eCollection 2016 Jun.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [40] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [41] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [42] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [45] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [46] Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
• [47] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [48] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [49] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [50] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [51] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [52] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [53] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [54] 6-(3,4-Dihydro-1H-isoquinoline-2-yl)-N-(6-methoxypyridine-2-yl) nicotinamide-26 (DIMN-26) decreases cell proliferation by induction of apoptosis and downregulation of androgen receptor signaling in human prostate cancer cells. Chem Biol Interact. 2016 Dec 25;260:196-207. doi: 10.1016/j.cbi.2016.10.008. Epub 2016 Oct 5.
• [55] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [56] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [57] BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
• [58] Acute and long-term effects of arsenite in HepG2 cells: modulation of insulin signaling. Biometals. 2014 Apr;27(2):317-32. doi: 10.1007/s10534-014-9714-y. Epub 2014 Feb 18.
• [59] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [60] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [61] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [62] 17beta-Estradiol differentially regulates androgen-responsive genes through estrogen receptor-beta- and extracellular-signal regulated kinase-dependent pathways in LNCaP human prostate cancer cells. Mol Carcinog. 2007 Feb;46(2):117-29. doi: 10.1002/mc.20254.