Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1M7D28)

• DOT Name: Granulocyte-macrophage colony-stimulating factor (CSF2)
• Synonyms: GM-CSF; Colony-stimulating factor; CSF; Molgramostin; Sargramostim
• Gene Name: CSF2
• UniProt ID: CSF2_HUMAN
• PDB ID: 1CSG; 2GMF; 4NKQ; 4RS1; 5C7X; 5D70; 5D71; 5D72; 6BFQ; 6BFS
• Pfam ID: PF01109
• Sequence:
  MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
  SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
  ESFKENLKDFLLVIPFDCWEPVQE
• Function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  JAK-STAT sig.ling pathway (hsa04630)
  Hematopoietic cell lineage (hsa04640)
  .tural killer cell mediated cytotoxicity (hsa04650)
  IL-17 sig.ling pathway (hsa04657)
  T cell receptor sig.ling pathway (hsa04660)
  Fc epsilon RI sig.ling pathway (hsa04664)
  TNF sig.ling pathway (hsa04668)
  Shigellosis (hsa05131)
  Amoebiasis (hsa05146)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Coro.virus disease - COVID-19 (hsa05171)
  Transcriptio.l misregulation in cancer (hsa05202)
  Acute myeloid leukemia (hsa05221)
  Rheumatoid arthritis (hsa05323)
• Reactome Pathway:
  RAF/MAP kinase cascade (R-HSA-5673001)
  Interleukin-10 signaling (R-HSA-6783783)
  RUNX1 regulates transcription of genes involved in differentiation of myeloid cells (R-HSA-8939246)
  Interleukin receptor SHC signaling (R-HSA-912526)
  Interleukin-3, Interleukin-5 and GM-CSF signaling (R-HSA-512988)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Granulocyte-macrophage colony-stimulating factor (CSF2) affects the response to substance of Temozolomide.	[46]
DTI-015	DMXZRW0	Approved	Granulocyte-macrophage colony-stimulating factor (CSF2) affects the response to substance of DTI-015.	[46]
Cyclophosphamide	DM4O2Z7	Approved	Granulocyte-macrophage colony-stimulating factor (CSF2) affects the activity of Cyclophosphamide.	[47]
Famotidine	DMRL3AB	Approved	Granulocyte-macrophage colony-stimulating factor (CSF2) increases the Bone marrow failure ADR of Famotidine.	[48]
Uracil mustard	DMHL7OB	Approved	Granulocyte-macrophage colony-stimulating factor (CSF2) increases the Skin and subcutaneous tissue disorders ADR of Uracil mustard.	[48]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[2]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[3]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[6]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[7]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[8]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[9]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[4]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[12]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[13]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[14]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[15]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[16]
Thalidomide	DM70BU5	Approved	Thalidomide decreases the activity of Granulocyte-macrophage colony-stimulating factor (CSF2).	[17]
Tacrolimus	DMZ7XNQ	Approved	Tacrolimus decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[19]
Dihydroxyacetone	DMM1LG2	Approved	Dihydroxyacetone increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[20]
Bleomycin	DMNER5S	Approved	Bleomycin increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[21]
Ergotidine	DM78IME	Approved	Ergotidine increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[22]
Betamethasone valerate	DMMIAXO	Approved	Betamethasone valerate decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[19]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[25]
Zarnestra	DMF30HL	Phase 3	Zarnestra decreases the activity of Granulocyte-macrophage colony-stimulating factor (CSF2).	[26]
BAICALEIN	DM4C7E6	Phase 2	BAICALEIN decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[3]
PIPERINE	DMYEAB1	Phase 1/2	PIPERINE decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[28]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[32]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[8]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[3]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[34]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[36]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[37]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[38]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[39]
Bilirubin	DMI0V4O	Investigative	Bilirubin increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[40]
USNIC ACID	DMGOURX	Investigative	USNIC ACID decreases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[44]
Beta-D-Glucose	DM5IHYP	Investigative	Beta-D-Glucose increases the expression of Granulocyte-macrophage colony-stimulating factor (CSF2).	[45]

15 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[10]
Nicotine	DMWX5CO	Approved	Nicotine increases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[11]
Docetaxel	DMDI269	Approved	Docetaxel increases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[18]
Budesonide	DMJIBAW	Approved	Budesonide decreases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[23]
Pomalidomide	DMTGBAX	Approved	Pomalidomide decreases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[24]
Acetylcholine	DMDF79Z	Approved	Acetylcholine increases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[11]
Fluticasone propionate	DMRWLB2	Approved	Fluticasone propionate decreases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[23]
Beclomethasone dipropionate	DM5NW1E	Phase 4	Beclomethasone dipropionate decreases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[23]
LTB4	DME26RS	Phase 2	LTB4 increases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[27]
Lipoteichoic acid	DMEMRW0	Phase 1/2	Lipoteichoic acid increases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[29]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[35]
acrolein	DMAMCSR	Investigative	acrolein decreases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[41]
Kaempferol	DMHEMUB	Investigative	Kaempferol increases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[18]
PD98059	DMZC90M	Investigative	PD98059 decreases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[42]
N-nonylphenol	DMH3OUX	Investigative	N-nonylphenol increases the secretion of Granulocyte-macrophage colony-stimulating factor (CSF2).	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Granulocyte-macrophage colony-stimulating factor (CSF2).	[30]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Granulocyte-macrophage colony-stimulating factor (CSF2).	[33]

References

• [1] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [2] Differential effects of trivalent and pentavalent arsenicals on cell proliferation and cytokine secretion in normal human epidermal keratinocytes. Toxicol Appl Pharmacol. 2001 May 1;172(3):225-32. doi: 10.1006/taap.2001.9152.
• [3] Effects of luteolin, quercetin and baicalein on immunoglobulin E-mediated mediator release from human cultured mast cells. Clin Exp Allergy. 2000 Apr;30(4):501-8. doi: 10.1046/j.1365-2222.2000.00768.x.
• [4] Cytokine mRNA profiles in cultured human skin component cells exposed to various chemicals: a simulation model of epicutaneous stimuli induced by skin barrier perturbation in comparison with that due to exposure to haptens or irritant. J Dermatol Sci. 2001 Jun;26(2):85-93. doi: 10.1016/s0923-1811(00)00165-1.
• [5] Increased inflammasome related gene expression profile in PBMC may facilitate T helper 17 cell induction in multiple sclerosis. Mol Immunol. 2015 Feb;63(2):521-9. doi: 10.1016/j.molimm.2014.10.008.
• [6] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [7] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [8] Effects of theophylline, dexamethasone and salbutamol on cytokine gene expression in human peripheral blood CD4+ T-cells. Eur Respir J. 1999 Nov;14(5):1106-12. doi: 10.1183/09031936.99.14511069.
• [9] Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
• [10] Altered cytokine profiles of human retinal pigment epithelium: oxidant injury and replicative senescence. Mol Vis. 2013;19:718-28. Epub 2013 Mar 21.
• [11] Acetylcholine and nicotine stimulate the release of granulocyte-macrophage colony stimulating factor from cultured human bronchial epithelial cells. Naunyn Schmiedebergs Arch Pharmacol. 1998 Apr;357(4):472-5. doi: 10.1007/pl00005195.
• [12] Dasatinib, a small-molecule protein tyrosine kinase inhibitor, inhibits T-cell activation and proliferation. Blood. 2008 Feb 1;111(3):1366-77. doi: 10.1182/blood-2007-04-084814. Epub 2007 Oct 25.
• [13] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [14] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [15] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [16] Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
• [17] Combination of thalidomide and cisplatin in an head and neck squamous cell carcinomas model results in an enhanced antiangiogenic activity in vitro and in vivo. Int J Cancer. 2007 Oct 15;121(8):1697-704. doi: 10.1002/ijc.22867.
• [18] Kaempferol and quercetin stimulate granulocyte-macrophage colony-stimulating factor secretion in human prostate cancer cells. Mol Cell Endocrinol. 2008 Jun 11;287(1-2):57-64. doi: 10.1016/j.mce.2008.01.015. Epub 2008 Feb 3.
• [19] Tacrolimus suppressed the production of cytokines involved in atopic dermatitis by direct stimulation of human PBMC system. (Comparison with steroids). Int Immunopharmacol. 2001 Jun;1(6):1219-26. doi: 10.1016/s1567-5769(01)00059-5.
• [20] The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
• [21] Agents associated with lung inflammation induce similar responses in NCI-H292 lung epithelial cells. Toxicol In Vitro. 2008 Oct;22(7):1782-8.
• [22] Human corneal epithelial cell functional responses to inflammatory agents and their antagonists. Invest Ophthalmol Vis Sci. 1998 Dec;39(13):2562-71.
• [23] Inhibition of GM-CSF secretion by topical corticosteroids and nedocromil sodium. A comparison study using nasal polyp epithelial cells. Respir Med. 2000 May;94(5):428-31. doi: 10.1053/rmed.1999.0756.
• [24] Immunomodulatory derivative of thalidomide (IMiD CC-4047) induces a shift in lineage commitment by suppressing erythropoiesis and promoting myelopoiesis. Blood. 2005 May 15;105(10):3833-40. doi: 10.1182/blood-2004-03-0828. Epub 2004 Aug 3.
• [25] Effects of resveratrol on gene expression in renal cell carcinoma. Cancer Biol Ther. 2004 Sep;3(9):882-8. doi: 10.4161/cbt.3.9.1056. Epub 2004 Sep 21.
• [26] Genetic disruption of the PI3K regulatory subunits, p85, p55, and p50, normalizes mutant PTPN11-induced hypersensitivity to GM-CSF. Haematologica. 2012 Jul;97(7):1042-7. doi: 10.3324/haematol.2011.046896. Epub 2012 Feb 7.
• [27] 5-oxo-6,8,11,14-eicosatetraenoic acid stimulates the release of the eosinophil survival factor granulocyte/macrophage colony-stimulating factor from monocytes. J Biol Chem. 2004 Jul 2;279(27):28159-64. doi: 10.1074/jbc.M401537200. Epub 2004 May 10.
• [28] Piperine is a potent inhibitor of nuclear factor-kappaB (NF-kappaB), c-Fos, CREB, ATF-2 and proinflammatory cytokine gene expression in B16F-10 melanoma cells. Int Immunopharmacol. 2004 Dec 20;4(14):1795-803. doi: 10.1016/j.intimp.2004.08.005.
• [29] Resveratrol attenuates the release of inflammatory cytokines from human bronchial smooth muscle cells exposed to lipoteichoic acid in chronic obstructive pulmonary disease. Basic Clin Pharmacol Toxicol. 2014 Feb;114(2):202-9. doi: 10.1111/bcpt.12129. Epub 2013 Sep 30.
• [30] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [31] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [32] MEK inhibition abrogates sunitinib resistance in a renal cell carcinoma patient-derived xenograft model. Br J Cancer. 2016 Oct 11;115(8):920-928. doi: 10.1038/bjc.2016.263. Epub 2016 Aug 25.
• [33] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [34] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [35] Acetaldehyde induces granulocyte macrophage colony-stimulating factor production in human bronchi through activation of nuclear factor-kappa B. Allergy Asthma Proc. 2003 Sep-Oct;24(5):367-71.
• [36] Paraquat exposure induces Parkinsonism by altering lipid profile and evoking neuroinflammation in the midbrain. Environ Int. 2022 Nov;169:107512. doi: 10.1016/j.envint.2022.107512. Epub 2022 Sep 8.
• [37] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [38] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [39] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [40] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [41] Acrolein inhibits cytokine gene expression by alkylating cysteine and arginine residues in the NF-kappaB1 DNA binding domain. J Biol Chem. 2007 Jul 6;282(27):19666-75. doi: 10.1074/jbc.M611527200. Epub 2007 May 9.
• [42] Mechanisms of GM-CSF increase by diesel exhaust particles in human airway epithelial cells. Am J Physiol Lung Cell Mol Physiol. 2000 Jan;278(1):L25-32. doi: 10.1152/ajplung.2000.278.1.L25.
• [43] Environmental levels of para-nonylphenol are able to affect cytokine secretion in human placenta. Environ Health Perspect. 2010 Mar;118(3):427-31. doi: 10.1289/ehp.0900882.
• [44] Effects of usnic acid exposure on human hepatoblastoma HepG2 cells in culture. J Appl Toxicol. 2012 Sep;32(9):722-30.
• [45] Cutting edge: distinct Toll-like receptor 2 activators selectively induce different classes of mediator production from human mast cells. J Immunol. 2003 Feb 15;170(4):1625-9. doi: 10.4049/jimmunol.170.4.1625.
• [46] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.
• [47] Reduction of plasma fibrinolytic activity following high-dose cyclophosphamide is neutralized in vivo by GM-CSF administration. Haematologica. 1993 Mar-Apr;78(2):105-10.
• [48] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.