Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3NZNTR)

• DOT Name: Methanethiol oxidase (SELENBP1)
• Synonyms: MTO; EC 1.8.3.4; 56 kDa selenium-binding protein; SBP56; SP56; Selenium-binding protein 1
• Gene Name: SELENBP1
• Related Disease:
  Type-1 diabetes
  Acute coronary syndrome
  Adenocarcinoma
  Cardiovascular disease
  Colorectal carcinoma
  Coronary heart disease
  Depression
  Diabetic kidney disease
  Epithelial ovarian cancer
  Essential hypertension
  Fatty liver disease
  Gastric cancer
  Gastric neoplasm
  Hepatocellular carcinoma
  Hereditary diffuse gastric adenocarcinoma
  Hypertension, pregnancy-induced
  Inborn error of metabolism
  Lung cancer
  Lung neoplasm
  Non-alcoholic fatty liver disease
  Non-insulin dependent diabetes
  Obesity
  Obstructive sleep apnea
  OPTN-related open angle glaucoma
  Ovarian cancer
  Ovarian neoplasm
  Peripheral arterial disease
  Psychotic disorder
  Schizoaffective disorder
  Advanced cancer
  Extraoral halitosis due to methanethiol oxidase deficiency
  Lung adenocarcinoma
  Stroke
  Type-1/2 diabetes
  Autosomal recessive extra-oral halitosis
  Coronary atherosclerosis
  Chronic kidney disease
  Classic Hodgkin lymphoma
  Colorectal neoplasm
  Huntington disease
  Lung carcinoma
  Orthostatic hypotension
  Schizophrenia
• UniProt ID: SBP1_HUMAN
• EC Number: 1.8.3.4
• Pfam ID: PF05694
• Sequence:
  MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVI
  HRLPMPNLKDELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHK
  VIEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERP
  GGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADVEAGLYGSHLYVWDWQRHEIVQ
  TLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKG
  WLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGP
  VQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIRE
  GSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI
• Function: Catalyzes the oxidation of methanethiol, an organosulfur compound known to be produced in substantial amounts by gut bacteria. Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport.
• Tissue Specificity: Widely expressed. Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two-fold up-regulated in brain and blood from schizophrenia patients.
• KEGG Pathway:
  Sulfur metabolism (hsa00920)
  Metabolic pathways (hsa01100)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[1]
Acute coronary syndrome	DIS7DYEW	Strong	Biomarker	[2]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[3]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[5]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[6]
Depression	DIS3XJ69	Strong	Biomarker	[7]
Diabetic kidney disease	DISJMWEY	Strong	Genetic Variation	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[9]
Essential hypertension	DIS7WI98	Strong	Biomarker	[10]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[11]
Gastric cancer	DISXGOUK	Strong	Biomarker	[12]
Gastric neoplasm	DISOKN4Y	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Biomarker	[12]
Hypertension, pregnancy-induced	DISHNU25	Strong	Altered Expression	[14]
Inborn error of metabolism	DISO5FAY	Strong	Biomarker	[15]
Lung cancer	DISCM4YA	Strong	Biomarker	[16]
Lung neoplasm	DISVARNB	Strong	Biomarker	[16]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[17]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[18]
Obesity	DIS47Y1K	Strong	Genetic Variation	[19]
Obstructive sleep apnea	DIS0SVD1	Strong	Genetic Variation	[20]
OPTN-related open angle glaucoma	DISDR98A	Strong	Biomarker	[21]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[9]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[9]
Peripheral arterial disease	DIS78WFB	Strong	Biomarker	[22]
Psychotic disorder	DIS4UQOT	Strong	Altered Expression	[23]
Schizoaffective disorder	DISLBW6B	Strong	Biomarker	[23]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[24]
Extraoral halitosis due to methanethiol oxidase deficiency	DISMYOUW	Moderate	Autosomal recessive	[25]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[16]
Stroke	DISX6UHX	moderate	Biomarker	[26]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[27]
Autosomal recessive extra-oral halitosis	DIS2I6LU	Supportive	Autosomal recessive	[15]
Coronary atherosclerosis	DISKNDYU	Disputed	Biomarker	[6]
Chronic kidney disease	DISW82R7	Limited	Biomarker	[28]
Classic Hodgkin lymphoma	DISV1LU6	Limited	Biomarker	[29]
Colorectal neoplasm	DISR1UCN	Limited	Biomarker	[30]
Huntington disease	DISQPLA4	Limited	Biomarker	[29]
Lung carcinoma	DISTR26C	Limited	Biomarker	[31]
Orthostatic hypotension	DISBKQGT	Limited	Biomarker	[32]
Schizophrenia	DISSRV2N	No Known	Unknown	[33]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Methanethiol oxidase (SELENBP1).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Methanethiol oxidase (SELENBP1).	[47]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Methanethiol oxidase (SELENBP1).	[48]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Methanethiol oxidase (SELENBP1).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Methanethiol oxidase (SELENBP1).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Methanethiol oxidase (SELENBP1).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Methanethiol oxidase (SELENBP1).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Methanethiol oxidase (SELENBP1).	[39]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Methanethiol oxidase (SELENBP1).	[40]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Methanethiol oxidase (SELENBP1).	[41]
Selenium	DM25CGV	Approved	Selenium increases the expression of Methanethiol oxidase (SELENBP1).	[42]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Methanethiol oxidase (SELENBP1).	[43]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Methanethiol oxidase (SELENBP1).	[38]
Estrone	DM5T6US	Approved	Estrone decreases the expression of Methanethiol oxidase (SELENBP1).	[38]
Estriol	DMOEM2I	Approved	Estriol decreases the expression of Methanethiol oxidase (SELENBP1).	[38]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Methanethiol oxidase (SELENBP1).	[44]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the expression of Methanethiol oxidase (SELENBP1).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Methanethiol oxidase (SELENBP1).	[46]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Methanethiol oxidase (SELENBP1).	[38]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Methanethiol oxidase (SELENBP1).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Methanethiol oxidase (SELENBP1).	[38]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Methanethiol oxidase (SELENBP1).	[50]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone decreases the expression of Methanethiol oxidase (SELENBP1).	[51]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Methanethiol oxidase (SELENBP1).	[52]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Methanethiol oxidase (SELENBP1).	[53]

References

• [1] Blood pressure, antihypertensive medication use, and risk of erectile dysfunction in men with type I diabetes.J Hypertens. 2019 May;37(5):1070-1076. doi: 10.1097/HJH.0000000000001988.
• [2] Hypertensive emergencies and urgencies: a single-centre experience in Northern Italy 2008-2015.J Hypertens. 2020 Jan;38(1):52-58. doi: 10.1097/HJH.0000000000002213.
• [3] Decreased selenium-binding protein 1 in esophageal adenocarcinoma results from posttranscriptional and epigenetic regulation and affects chemosensitivity.Clin Cancer Res. 2010 Apr 1;16(7):2009-21. doi: 10.1158/1078-0432.CCR-09-2801. Epub 2010 Mar 23.
• [4] Associations of blood pressure categories defined by 2017 ACC/AHA guidelines with mortality in China: Pooled results from three prospective cohorts.Eur J Prev Cardiol. 2020 Mar;27(4):345-354. doi: 10.1177/2047487319862066. Epub 2019 Jul 9.
• [5] Selenium-binding protein 1 is associated with the degree of colorectal cancer differentiation and is regulated by histone modification.Oncol Rep. 2014 Jun;31(6):2506-14. doi: 10.3892/or.2014.3141. Epub 2014 Apr 16.
• [6] SBP above 180mmHg at moderate exercise workload increases coronary heart disease risk in healthy men during 28-year follow-up.J Hypertens. 2019 May;37(5):949-955. doi: 10.1097/HJH.0000000000001959.
• [7] Relationships between depression and anxiety symptoms scores and blood pressure in young adults.J Hypertens. 2017 Oct;35(10):1983-1991. doi: 10.1097/HJH.0000000000001410.
• [8] Prognostic value of visit-to-visit systolic blood pressure variability related to diabetic kidney disease among patients with type 2 diabetes.J Hypertens. 2019 Jul;37(7):1411-1418. doi: 10.1097/HJH.0000000000002038.
• [9] Selenium-Binding Protein 1 expression in ovaries and ovarian tumors in the laying hen, a spontaneous model of human ovarian cancer.Gynecol Oncol. 2008 Apr;109(1):115-21. doi: 10.1016/j.ygyno.2007.12.030. Epub 2008 Feb 13.
• [10] Effects of sodium nitrite on renal function and blood pressure in hypertensive vs. healthy study participants: a randomized, placebo-controlled, crossover study.J Hypertens. 2018 Mar;36(3):666-679. doi: 10.1097/HJH.0000000000001598.
• [11] Atherogenic index of plasma is a novel and strong predictor associated with fatty liver: a cross-sectional study in the Chinese Han population.Lipids Health Dis. 2019 Sep 12;18(1):170. doi: 10.1186/s12944-019-1112-6.
• [12] Two-dimensional differential in-gel electrophoresis for identification of gastric cancer-specific protein markers.Oncol Rep. 2009 Jun;21(6):1429-37. doi: 10.3892/or_00000371.
• [13] Invasive potential of hepatocellular carcinoma is enhanced by loss of selenium-binding protein 1 and subsequent upregulation of CXCR4.Am J Cancer Res. 2018 Jun 1;8(6):1040-1049. eCollection 2018.
• [14] Feature of trajectory of blood pressure among pregnant women with gestational hypertension.J Hypertens. 2020 Jan;38(1):127-132. doi: 10.1097/HJH.0000000000002197.
• [15] Mutations in SELENBP1, encoding a novel human methanethiol oxidase, cause extraoral halitosis. Nat Genet. 2018 Jan;50(1):120-129. doi: 10.1038/s41588-017-0006-7. Epub 2017 Dec 18.
• [16] Tumor Suppressor Activity of Selenbp1, a Direct Nkx2-1 Target, in Lung Adenocarcinoma.Mol Cancer Res. 2018 Nov;16(11):1737-1749. doi: 10.1158/1541-7786.MCR-18-0392. Epub 2018 Jul 12.
• [17] The impact of the sleep duration on NAFLD score in Korean middle-aged adults: a community-based cohort study.Sleep Med. 2019 May;57:144-150. doi: 10.1016/j.sleep.2019.02.012. Epub 2019 Mar 2.
• [18] Safety and efficacy of ertugliflozin in Asian patients with type 2 diabetes mellitus inadequately controlled with metformin monotherapy: VERTIS Asia.Diabetes Obes Metab. 2019 Jun;21(6):1474-1482. doi: 10.1111/dom.13681. Epub 2019 Apr 5.
• [19] Hypertension in aortic stenosis: relationship with revealed symptoms and functional measures on treadmill exercise.J Hypertens. 2019 Nov;37(11):2209-2215. doi: 10.1097/HJH.0000000000002149.
• [20] Renal artery denervation for treatment of patients with self-reported obstructive sleep apnea and resistant hypertension: results from the Global SYMPLICITY Registry.J Hypertens. 2017 Jan;35(1):148-153. doi: 10.1097/HJH.0000000000001142.
• [21] Inter-relationship between ocular perfusion pressure, blood pressure, intraocular pressure profiles and primary open-angle glaucoma: the Singapore Epidemiology of Eye Diseases study.Br J Ophthalmol. 2018 Oct;102(10):1402-1406. doi: 10.1136/bjophthalmol-2017-311359. Epub 2018 Jan 13.
• [22] Cohort Study Examining the Association Between Blood Pressure and Cardiovascular Events in Patients With Peripheral Artery Disease.J Am Heart Assoc. 2019 Mar 19;8(6):e010748. doi: 10.1161/JAHA.118.010748.
• [23] The utility of SELENBP1 gene expression as a biomarker for major psychotic disorders: replication in schizophrenia and extension to bipolar disorder with psychosis.Am J Med Genet B Neuropsychiatr Genet. 2008 Sep 5;147B(6):686-9. doi: 10.1002/ajmg.b.30664.
• [24] Selenium-Binding Protein 1 in Human Health and Disease.Int J Mol Sci. 2018 Nov 2;19(11):3437. doi: 10.3390/ijms19113437.
• [25] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [26] Inter-arm difference of systolic blood pressure measured by automated double-cuff device is associated with arterial stiffness in patients with hypertension.Blood Press Monit. 2020 Feb;25(1):26-33. doi: 10.1097/MBP.0000000000000416.
• [27] Chronic kidney disease progression in patients with resistant hypertension subject to 2 therapeutic strategies: Intensification with loop diuretics vs aldosterone antagonists.Nefrologia (Engl Ed). 2020 Jan-Feb;40(1):65-73. doi: 10.1016/j.nefro.2019.04.012. Epub 2019 Aug 23.
• [28] Long-term blood pressure variability and development of chronic kidney disease in type 2 diabetes.J Hypertens. 2019 Apr;37(4):805-813. doi: 10.1097/HJH.0000000000001950.
• [29] Forecast post-dialysis blood pressure in hemodialysis patients with intradialytic hypertension.Clin Exp Hypertens. 2019;41(6):571-576. doi: 10.1080/10641963.2018.1523916. Epub 2018 Oct 16.
• [30] Expression of selenium-binding protein 1 characterizes intestinal cell maturation and predicts survival for patients with colorectal cancer.Mol Nutr Food Res. 2008 Nov;52(11):1289-99. doi: 10.1002/mnfr.200700331.
• [31] Selenium-binding protein 1 is down-regulated in malignant melanoma.Oncotarget. 2018 Jan 2;9(12):10445-10456. doi: 10.18632/oncotarget.23853. eCollection 2018 Feb 13.
• [32] Association of Orthostatic Hypotension Timing With Clinical Events in Adults With Diabetes and Hypertension: Results From the ACCORD Trial.Am J Hypertens. 2019 Jun 11;32(7):684-694. doi: 10.1093/ajh/hpz015.
• [33] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [34] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Using a customized DNA microarray for expression profiling of the estrogen-responsive genes to evaluate estrogen activity among natural estrogens and industrial chemicals. Environ Health Perspect. 2004 May;112(7):773-81. doi: 10.1289/ehp.6753.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [41] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [42] Selenium binding protein 1 in ovarian cancer. Int J Cancer. 2006 May 15;118(10):2433-40. doi: 10.1002/ijc.21671.
• [43] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [44] Differentially expressed genes in the prostate cancer cell line LNCaP after exposure to androgen and anti-androgen. Cancer Genet Cytogenet. 2006 Apr 15;166(2):130-8. doi: 10.1016/j.cancergencyto.2005.09.012.
• [45] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [46] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [47] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [48] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [51] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [52] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [53] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.