Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHHPZQ8)

DOT Name Protein S100-A6 (S100A6)
Synonyms Calcyclin; Growth factor-inducible protein 2A9; MLN 4; Prolactin receptor-associated protein; PRA; S100 calcium-binding protein A6
Gene Name S100A6
UniProt ID
S10A6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1K8U; 1K96; 1K9K; 1K9P; 2M1K; 4YBH
Pfam ID
PF01023
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL
DRNKDQEVNFQEYVTFLGALALIYNEALKG
Function
May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
33 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Protein S100-A6 (S100A6). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Protein S100-A6 (S100A6). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Protein S100-A6 (S100A6). [3]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Protein S100-A6 (S100A6). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Protein S100-A6 (S100A6). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Protein S100-A6 (S100A6). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein S100-A6 (S100A6). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Protein S100-A6 (S100A6). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Protein S100-A6 (S100A6). [9]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Protein S100-A6 (S100A6). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Protein S100-A6 (S100A6). [11]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Protein S100-A6 (S100A6). [12]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Protein S100-A6 (S100A6). [13]
Selenium DM25CGV Approved Selenium increases the expression of Protein S100-A6 (S100A6). [14]
Menadione DMSJDTY Approved Menadione affects the expression of Protein S100-A6 (S100A6). [15]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Protein S100-A6 (S100A6). [16]
Simvastatin DM30SGU Approved Simvastatin increases the expression of Protein S100-A6 (S100A6). [17]
Mifepristone DMGZQEF Approved Mifepristone decreases the expression of Protein S100-A6 (S100A6). [18]
Adenosine triphosphate DM79F6G Approved Adenosine triphosphate increases the expression of Protein S100-A6 (S100A6). [19]
Miglitol DMXBQAM Approved Miglitol decreases the expression of Protein S100-A6 (S100A6). [20]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Protein S100-A6 (S100A6). [16]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Protein S100-A6 (S100A6). [21]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Protein S100-A6 (S100A6). [14]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Protein S100-A6 (S100A6). [22]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Protein S100-A6 (S100A6). [23]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Protein S100-A6 (S100A6). [24]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the expression of Protein S100-A6 (S100A6). [21]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Protein S100-A6 (S100A6). [25]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Protein S100-A6 (S100A6). [26]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Protein S100-A6 (S100A6). [27]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Protein S100-A6 (S100A6). [28]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of Protein S100-A6 (S100A6). [22]
Manganese DMKT129 Investigative Manganese increases the expression of Protein S100-A6 (S100A6). [29]
------------------------------------------------------------------------------------
⏷ Show the Full List of 33 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Retinoic acid and hydroquinone induce inverse expression patterns on cornified envelope-associated proteins: implication in skin irritation. J Dermatol Sci. 2014 Nov;76(2):112-9. doi: 10.1016/j.jdermsci.2014.08.003. Epub 2014 Aug 26.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Characterisation of cisplatin-induced transcriptomics responses in primary mouse hepatocytes, HepG2 cells and mouse embryonic stem cells shows conservation of regulating transcription factor networks. Mutagenesis. 2014 Jan;29(1):17-26.
7 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
11 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
12 The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
13 Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
14 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
15 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
16 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
17 Simvastatin inactivates beta1-integrin and extracellular signal-related kinase signaling and inhibits cell proliferation in head and neck squamous cell carcinoma cells. Cancer Sci. 2007 Jun;98(6):890-9.
18 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
19 Extracellular ATP drives breast cancer cell migration and metastasis via S100A4 production by cancer cells and fibroblasts. Cancer Lett. 2018 Aug 28;430:1-10. doi: 10.1016/j.canlet.2018.04.043. Epub 2018 May 5.
20 The -glucosidase inhibitor miglitol decreases glucose fluctuations and inflammatory cytokine gene expression in peripheral leukocytes of Japanese patients with type 2 diabetes mellitus. Metabolism. 2010 Dec;59(12):1816-22. doi: 10.1016/j.metabol.2010.06.006. Epub 2010 Jul 29.
21 Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
22 Emptying of intracellular calcium pool and oxidative stress imbalance are associated with the glyphosate-induced proliferation in human skin keratinocytes HaCaT cells. ISRN Dermatol. 2013 Aug 29;2013:825180.
23 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
24 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
25 Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
26 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
27 Identification of formaldehyde-responsive genes by suppression subtractive hybridization. Toxicology. 2008 Jan 14;243(1-2):224-35.
28 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
29 Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.