Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQC6PPO)

• DOT Name: Collagen alpha-2(VI) chain (COL6A2)
• Synonyms: Collagen alpha-2(VI) chain
• Gene Name: COL6A2
• Related Disease:
  Collagen 6-related myopathy
  Congenital muscular dystrophy
  Ullrich congenital muscular dystrophy 1A
  Aural atresia, congenital
  Bethlem myopathy 1A
  Glycogen storage disease III
  Limb-girdle muscular dystrophy
  Muscular dystrophy
  Pancreatic cancer
  Progressive myoclonus epilepsy
  Unverricht-Lundborg syndrome
  Atopic dermatitis
  Hirschsprung disease
  Keratosis pilaris
  Myopathy
  Bethlem myopathy
  Myosclerosis
  Ullrich congenital muscular dystrophy
  Asthma
  Chronic obstructive pulmonary disease
  Osteoarthritis
• UniProt ID: CO6A2_HUMAN
• Pfam ID: PF01391 ; PF00092
• Sequence:
  MLQGTCSVLLLWGILGAIQAQQQEVISPDTTERNNNCPEKTDCPIHVYFVLDTSESVTMQ
  SPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIK
  NLQGISSFRRGTFTDCALANMTEQIRQDRSKGTVHFAVVITDGHVTGSPCGGIKLQAERA
  REEGIRLFAVAPNQNLKEQGLRDIASTPHELYRNDYATMLPDSTEIDQDTINRIIKVMKH
  EAYGECYKVSCLEIPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPK
  GVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEA
  GSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPK
  GEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRGLPGPRGPQGAL
  GEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGEKGEPGPRGPEGGRG
  DFGLKGEPGRKGEKGEPADPGPPGEPGPRGPRGVPGPEGEPGPPGDPGLTECDVMTYVRE
  TCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRLGAIAKDPKSETGTRV
  GVVQYSHEGTFEAIQLDDERIDSLSSFKEAVKNLEWIAGGTWTPSALKFAYDRLIKESRR
  QKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHEKHESENLYSIACDKP
  QQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPCQTELSVAQCTQRPVDIVFLLDG
  SERLGEQNFHKARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTA
  IHEALETTQYLNSFSHVGAGVVHAINAIVRSPRGGARRHAELSFVFLTDGVTGNDSLHES
  AHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIRWIC
• Function: Collagen VI acts as a cell-binding protein.
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Cytoskeleton in muscle cells (hsa04820)
  Protein digestion and absorption (hsa04974)
  Human papillomavirus infection (hsa05165)
• Reactome Pathway:
  Collagen biosynthesis and modifying enzymes (R-HSA-1650814)
  Signaling by PDGF (R-HSA-186797)
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)
  Integrin cell surface interactions (R-HSA-216083)
  ECM proteoglycans (R-HSA-3000178)
  NCAM1 interactions (R-HSA-419037)
  Collagen chain trimerization (R-HSA-8948216)
  Collagen degradation (R-HSA-1442490)

Molecular Interaction Atlas (MIA) of This DOT

21 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Collagen 6-related myopathy	DISF4E3M	Definitive	Autosomal dominant	[1]
Congenital muscular dystrophy	DISKY7OY	Definitive	Genetic Variation	[2]
Ullrich congenital muscular dystrophy 1A	DISFHHF0	Definitive	Autosomal dominant	[3]
Aural atresia, congenital	DISCP7UV	Strong	Biomarker	[4]
Bethlem myopathy 1A	DIS0ATYV	Strong	Autosomal dominant	[5]
Glycogen storage disease III	DISTXQ1P	Strong	Genetic Variation	[6]
Limb-girdle muscular dystrophy	DISI9Y1Z	Strong	Genetic Variation	[7]
Muscular dystrophy	DISJD6P7	Strong	Genetic Variation	[8]
Pancreatic cancer	DISJC981	Strong	Biomarker	[9]
Progressive myoclonus epilepsy	DISAMCNS	Strong	Genetic Variation	[10]
Unverricht-Lundborg syndrome	DISG4WLX	Strong	Genetic Variation	[10]
Atopic dermatitis	DISTCP41	moderate	Genetic Variation	[11]
Hirschsprung disease	DISUUSM1	moderate	Biomarker	[12]
Keratosis pilaris	DISKOBPU	moderate	Genetic Variation	[11]
Myopathy	DISOWG27	moderate	Genetic Variation	[13]
Bethlem myopathy	DISVF5K2	Supportive	Autosomal dominant	[14]
Myosclerosis	DISXVMI3	Supportive	Autosomal recessive	[15]
Ullrich congenital muscular dystrophy	DISJWD0V	Supportive	Autosomal dominant	[8]
Asthma	DISW9QNS	Limited	Biomarker	[16]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Altered Expression	[16]
Osteoarthritis	DIS05URM	Limited	Biomarker	[17]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Collagen alpha-2(VI) chain (COL6A2) affects the response to substance of Topotecan.	[37]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Collagen alpha-2(VI) chain (COL6A2).	[18]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Collagen alpha-2(VI) chain (COL6A2).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Collagen alpha-2(VI) chain (COL6A2).	[33]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Collagen alpha-2(VI) chain (COL6A2).	[19]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Collagen alpha-2(VI) chain (COL6A2).	[20]
Selenium	DM25CGV	Approved	Selenium increases the expression of Collagen alpha-2(VI) chain (COL6A2).	[21]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Collagen alpha-2(VI) chain (COL6A2).	[23]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Collagen alpha-2(VI) chain (COL6A2).	[24]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Collagen alpha-2(VI) chain (COL6A2).	[25]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone affects the expression of Collagen alpha-2(VI) chain (COL6A2).	[26]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Collagen alpha-2(VI) chain (COL6A2).	[27]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Collagen alpha-2(VI) chain (COL6A2).	[28]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Collagen alpha-2(VI) chain (COL6A2).	[29]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Collagen alpha-2(VI) chain (COL6A2).	[30]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Collagen alpha-2(VI) chain (COL6A2).	[31]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Collagen alpha-2(VI) chain (COL6A2).	[21]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Collagen alpha-2(VI) chain (COL6A2).	[34]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Collagen alpha-2(VI) chain (COL6A2).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Collagen alpha-2(VI) chain (COL6A2).	[36]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol affects the secretion of Collagen alpha-2(VI) chain (COL6A2).	[32]
D-glucose	DMMG2TO	Investigative	D-glucose affects the secretion of Collagen alpha-2(VI) chain (COL6A2).	[32]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] EMG and nerve conduction studies in children with congenital muscular dystrophy.Muscle Nerve. 2004 Feb;29(2):292-9. doi: 10.1002/mus.10544.
• [3] Dominant collagen VI mutations are a common cause of Ullrich congenital muscular dystrophy. Hum Mol Genet. 2005 Jan 15;14(2):279-93. doi: 10.1093/hmg/ddi025. Epub 2004 Nov 24.
• [4] Proteomics analysis identifies new markers associated with capillary cerebral amyloid angiopathy in Alzheimer's disease.Acta Neuropathol Commun. 2018 Jun 4;6(1):46. doi: 10.1186/s40478-018-0540-2.
• [5] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [6] Study of consanguineous populations can improve the annotation of SNP databases.Eur J Med Genet. 2011 Mar-Apr;54(2):118-20. doi: 10.1016/j.ejmg.2010.10.009. Epub 2010 Oct 28.
• [7] A novel COL6A2 mutation causing late-onset limb-girdle muscular dystrophy.J Neurol. 2019 Jul;266(7):1649-1654. doi: 10.1007/s00415-019-09307-y. Epub 2019 Apr 8.
• [8] Exon skipping mutations in collagen VI are common and are predictive for severity and inheritance. Hum Mutat. 2008 Jun;29(6):809-22. doi: 10.1002/humu.20704.
• [9] Association of Common Susceptibility Variants of Pancreatic Cancer in Higher-Risk Patients: A PACGENE Study.Cancer Epidemiol Biomarkers Prev. 2016 Jul;25(7):1185-91. doi: 10.1158/1055-9965.EPI-15-1217. Epub 2016 May 16.
• [10] Identification of COL6A2 mutations in progressive myoclonus epilepsy syndrome.Hum Genet. 2013 Mar;132(3):275-83. doi: 10.1007/s00439-012-1248-1. Epub 2012 Nov 9.
• [11] Expression of the collagen VI 5 and 6 chains in normal human skin and in skin of patients with collagen VI-related myopathies.J Invest Dermatol. 2011 Jan;131(1):99-107. doi: 10.1038/jid.2010.284. Epub 2010 Sep 30.
• [12] A collagen VI-dependent pathogenic mechanism for Hirschsprung's disease.J Clin Invest. 2015 Dec;125(12):4483-96. doi: 10.1172/JCI83178. Epub 2015 Nov 16.
• [13] Ten years of screening for congenital disorders of glycosylation in Argentina: case studies and pitfalls.Pediatr Res. 2018 Dec;84(6):837-841. doi: 10.1038/s41390-018-0206-6. Epub 2018 Oct 18.
• [14] Collagen VI-Related Dystrophies. 2004 Jun 25 [updated 2021 Mar 11]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [15] Autosomal recessive myosclerosis myopathy is a collagen VI disorder. Neurology. 2008 Oct 14;71(16):1245-53. doi: 10.1212/01.wnl.0000327611.01687.5e.
• [16] Toxicological effects of ambient fine (PM(2.5-0.18)) and ultrafine (PM(0.18)) particles in healthy and diseased 3D organo-typic mucocilary-phenotype models.Environ Res. 2019 Sep;176:108538. doi: 10.1016/j.envres.2019.108538. Epub 2019 Jun 15.
• [17] Mitochondrial dysregulation of osteoarthritic human articular chondrocytes analyzed by proteomics: a decrease in mitochondrial superoxide dismutase points to a redox imbalance.Mol Cell Proteomics. 2009 Jan;8(1):172-89. doi: 10.1074/mcp.M800292-MCP200. Epub 2008 Sep 9.
• [18] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [19] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [20] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [21] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [22] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [23] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [24] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [25] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [26] Proteomic analysis of human adipose tissue after rosiglitazone treatment shows coordinated changes to promote glucose uptake. Obesity (Silver Spring). 2010 Jan;18(1):27-34. doi: 10.1038/oby.2009.208. Epub 2009 Jun 25.
• [27] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [28] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [29] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [30] Increased expression of type VI collagen genes in drug-induced gingival enlargement. FEBS Lett. 1993 Nov 8;334(1):65-8. doi: 10.1016/0014-5793(93)81681-o.
• [31] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [32] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [33] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [34] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [35] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [36] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [37] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.