Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRNNSFM)

DOT Name Inhibitor of growth protein 5 (ING5)
Synonyms p28ING5
Gene Name ING5
Related Disease
Squamous cell carcinoma ( )
Adenocarcinoma ( )
Bladder cancer ( )
Bone osteosarcoma ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Glioma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Hepatitis B virus infection ( )
Hepatocellular carcinoma ( )
Lung carcinoma ( )
Metastatic sarcoma ( )
Neoplasm ( )
Oral cancer ( )
Osteosarcoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pancreatic cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Pulmonary fibrosis ( )
Small-cell lung cancer ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Carcinoma ( )
Adult glioblastoma ( )
Advanced cancer ( )
Benign neoplasm ( )
Breast cancer ( )
Breast carcinoma ( )
Glioblastoma multiforme ( )
Lung cancer ( )
Mucinous adenocarcinoma ( )
Neuroblastoma ( )
Small lymphocytic lymphoma ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
UniProt ID
ING5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3C6W; 5ME8; 5MTO
Pfam ID
PF12998
Sequence
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ
RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDF
ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP
VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
Function
Component of the HBO1 complex, which specifically mediates acetylation of histone H3 at 'Lys-14' (H3K14ac) and, to a lower extent, acetylation of histone H4. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Through chromatin acetylation it may regulate DNA replication and may function as a transcriptional coactivator. Inhibits cell growth, induces a delay in S-phase progression and enhances Fas-induced apoptosis in an INCA1-dependent manner.
Tissue Specificity Down-regulated in bone marrow cells in acute myeloid leukemia patients as compared with normal bone marrow cells.
Reactome Pathway
Regulation of TP53 Activity through Acetylation (R-HSA-6804758 )
HATs acetylate histones (R-HSA-3214847 )

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Squamous cell carcinoma DISQVIFL Definitive Altered Expression [1]
Adenocarcinoma DIS3IHTY Strong Altered Expression [1]
Bladder cancer DISUHNM0 Strong Altered Expression [2]
Bone osteosarcoma DIST1004 Strong Altered Expression [3]
Endometrial carcinoma DISXR5CY Strong Altered Expression [4]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [5]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [6]
Glioma DIS5RPEH Strong Altered Expression [7]
Head and neck cancer DISBPSQZ Strong Biomarker [8]
Head and neck carcinoma DISOU1DS Strong Biomarker [8]
Hepatitis B virus infection DISLQ2XY Strong Altered Expression [9]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [4]
Lung carcinoma DISTR26C Strong Altered Expression [10]
Metastatic sarcoma DISKYC7V Strong Altered Expression [11]
Neoplasm DISZKGEW Strong Biomarker [12]
Oral cancer DISLD42D Strong Biomarker [13]
Osteosarcoma DISLQ7E2 Strong Altered Expression [3]
Ovarian cancer DISZJHAP Strong Altered Expression [5]
Ovarian neoplasm DISEAFTY Strong Altered Expression [5]
Pancreatic cancer DISJC981 Strong Altered Expression [4]
Prostate cancer DISF190Y Strong Biomarker [14]
Prostate carcinoma DISMJPLE Strong Biomarker [14]
Pulmonary fibrosis DISQKVLA Strong Biomarker [15]
Small-cell lung cancer DISK3LZD Strong Altered Expression [1]
Stomach cancer DISKIJSX Strong Altered Expression [11]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [2]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [2]
Carcinoma DISH9F1N moderate Altered Expression [11]
Adult glioblastoma DISVP4LU Limited Biomarker [16]
Advanced cancer DISAT1Z9 Limited Biomarker [14]
Benign neoplasm DISDUXAD Limited Altered Expression [17]
Breast cancer DIS7DPX1 Limited Altered Expression [18]
Breast carcinoma DIS2UE88 Limited Altered Expression [18]
Glioblastoma multiforme DISK8246 Limited Biomarker [16]
Lung cancer DISCM4YA Limited Altered Expression [10]
Mucinous adenocarcinoma DISKNFE8 Limited Altered Expression [17]
Neuroblastoma DISVZBI4 Limited Biomarker [19]
Small lymphocytic lymphoma DIS30POX Limited Biomarker [20]
Thyroid cancer DIS3VLDH Limited Biomarker [21]
Thyroid gland carcinoma DISMNGZ0 Limited Biomarker [21]
Thyroid tumor DISLVKMD Limited Biomarker [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 41 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Afimoxifene DMFORDT Phase 2 Inhibitor of growth protein 5 (ING5) affects the response to substance of Afimoxifene. [34]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Inhibitor of growth protein 5 (ING5). [22]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Inhibitor of growth protein 5 (ING5). [23]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Inhibitor of growth protein 5 (ING5). [24]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Inhibitor of growth protein 5 (ING5). [25]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Inhibitor of growth protein 5 (ING5). [26]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Inhibitor of growth protein 5 (ING5). [27]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Inhibitor of growth protein 5 (ING5). [28]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Inhibitor of growth protein 5 (ING5). [29]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Inhibitor of growth protein 5 (ING5). [30]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Inhibitor of growth protein 5 (ING5). [32]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Inhibitor of growth protein 5 (ING5). [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Inhibitor of growth protein 5 (ING5). [31]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Inhibitor of growth protein 5 (ING5). [31]
------------------------------------------------------------------------------------

References

1 The down-regulated ING5 expression in lung cancer: a potential target of gene therapy.Oncotarget. 2016 Aug 23;7(34):54596-54615. doi: 10.18632/oncotarget.10519.
2 The miR-193a-3p-regulated ING5 gene activates the DNA damage response pathway and inhibits multi-chemoresistance in bladder cancer.Oncotarget. 2015 Apr 30;6(12):10195-206. doi: 10.18632/oncotarget.3555.
3 Up-regulated MiR-27-3p promotes the G1-S phase transition by targeting inhibitor of growth family member 5 in osteosarcoma.Biomed Pharmacother. 2018 May;101:219-227. doi: 10.1016/j.biopha.2018.02.066. Epub 2018 Feb 26.
4 Expression pattern and level of ING5 protein in normal and cancer tissues.Oncol Lett. 2019 Jan;17(1):63-68. doi: 10.3892/ol.2018.9581. Epub 2018 Oct 16.
5 MiR-1307 promotes ovarian cancer cell chemoresistance by targeting the ING5 expression.J Ovarian Res. 2017 Jan 11;10(1):1. doi: 10.1186/s13048-016-0301-4.
6 ING5 inhibits cell proliferation and invasion in esophageal squamous cell carcinoma through regulation of the Akt/NF-B/MMP-9 signaling pathway.Biochem Biophys Res Commun. 2018 Feb 5;496(2):387-393. doi: 10.1016/j.bbrc.2018.01.045. Epub 2018 Jan 8.
7 The roles of ING5 in gliomas: a good marker for tumorigenesis and a potential target for gene therapy.Oncotarget. 2017 May 11;8(34):56558-56568. doi: 10.18632/oncotarget.17802. eCollection 2017 Aug 22.
8 Exosomal miR-196a derived from cancer-associated fibroblasts confers cisplatin resistance in head and neck cancer through targeting CDKN1B and ING5.Genome Biol. 2019 Jan 14;20(1):12. doi: 10.1186/s13059-018-1604-0.
9 Upregulated in Hepatitis B virus-associated hepatocellular carcinoma cells, miR-331-3p promotes proliferation of hepatocellular carcinoma cells by targeting ING5.Oncotarget. 2015 Nov 10;6(35):38093-106. doi: 10.18632/oncotarget.5642.
10 ING5 inhibits lung cancer invasion and epithelial-mesenchymal transition by inhibiting the WNT/-catenin pathway.Thorac Cancer. 2019 Apr;10(4):848-855. doi: 10.1111/1759-7714.13013. Epub 2019 Feb 27.
11 The altered expression of ING5 protein is involved in gastric carcinogenesis and subsequent progression.Hum Pathol. 2011 Jan;42(1):25-35. doi: 10.1016/j.humpath.2010.05.024. Epub 2010 Nov 9.
12 The Tumor Suppressor ING5 Is a Dimeric, Bivalent Recognition Molecule of the Histone H3K4me3 Mark.J Mol Biol. 2019 May 31;431(12):2298-2319. doi: 10.1016/j.jmb.2019.04.018. Epub 2019 Apr 24.
13 Tumor-specific mutation and downregulation of ING5 detected in oral squamous cell carcinoma.Int J Cancer. 2010 Nov 1;127(9):2088-94. doi: 10.1002/ijc.25224.
14 ING5 inhibits cancer aggressiveness by inhibiting Akt and activating p53 in prostate cancer.Cell Biol Int. 2020 Jan;44(1):242-252. doi: 10.1002/cbin.11227. Epub 2019 Sep 10.
15 Expression analysis of microRNAs and mRNAs in myofibroblast differentiation of lung resident mesenchymal stem cells.Differentiation. 2020 Mar-Apr;112:10-16. doi: 10.1016/j.diff.2019.11.002. Epub 2019 Dec 10.
16 ING5 activity in self-renewal of glioblastoma stem cells via calcium and follicle stimulating hormone pathways.Oncogene. 2018 Jan 18;37(3):286-301. doi: 10.1038/onc.2017.324. Epub 2017 Sep 18.
17 The roles of ING5 expression in ovarian carcinogenesis and subsequent progression: a target of gene therapy.Oncotarget. 2017 Oct 19;8(61):103449-103464. doi: 10.18632/oncotarget.21968. eCollection 2017 Nov 28.
18 The nucleocytoplasmic translocation and up-regulation of ING5 protein in breast cancer: a potential target for gene therapy.Oncotarget. 2017 May 17;8(47):81953-81966. doi: 10.18632/oncotarget.17918. eCollection 2017 Oct 10.
19 ING5-mediated antineuroblastoma effects of suberoylanilide hydroxamic acid.Cancer Med. 2018 Sep;7(9):4554-4569. doi: 10.1002/cam4.1634. Epub 2018 Aug 9.
20 Cytokinesis arrest and multiple centrosomes in B cell chronic lymphocytic leukaemia.J Cell Mol Med. 2018 May;22(5):2846-2855. doi: 10.1111/jcmm.13579. Epub 2018 Mar 7.
21 Overexpression of ING5 inhibits HGF-induced proliferation, invasion and EMT in thyroid cancer cells via regulation of the c-Met/PI3K/Akt signaling pathway.Biomed Pharmacother. 2018 Feb;98:265-270. doi: 10.1016/j.biopha.2017.12.045. Epub 2017 Dec 27.
22 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
23 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
24 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
25 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
26 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
27 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
28 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
29 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
30 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
31 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
32 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
33 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
34 Genome-wide functional screen identifies a compendium of genes affecting sensitivity to tamoxifen. Proc Natl Acad Sci U S A. 2012 Feb 21;109(8):2730-5. doi: 10.1073/pnas.1018872108. Epub 2011 Apr 11.