Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSUFH1H)

• DOT Name: Doublecortin domain-containing protein 2 (DCDC2)
• Synonyms: Protein RU2S
• Gene Name: DCDC2
• Related Disease:
  Ciliopathy
  Hepatocellular carcinoma
  Nervous system disease
  Type-1/2 diabetes
  Acute myelogenous leukaemia
  Adenocarcinoma
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Attention deficit hyperactivity disorder
  Bladder cancer
  Brain neoplasm
  Glioblastoma multiforme
  Hepatitis C virus infection
  Isolated neonatal sclerosing cholangitis
  Language disorder
  leukaemia
  Leukemia
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Major depressive disorder
  Myelodysplastic syndrome
  Neoplasm
  Nephronophthisis
  Nephronophthisis 19
  Non-small-cell lung cancer
  Obesity
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Schizophrenia
  Small lymphocytic lymphoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Cardiovascular disease
  Colon cancer
  Colon carcinoma
  Hearing loss, autosomal recessive
  Senior-Boichis syndrome
  Autosomal recessive nonsyndromic hearing loss 66
  Breast cancer
  Breast carcinoma
  Chronic obstructive pulmonary disease
  Neuroblastoma
  Nonsyndromic genetic hearing loss
  Plasma cell myeloma
  Pneumonia
  Stroke
  Triple negative breast cancer
• UniProt ID: DCDC2_HUMAN
• PDB ID: 2DNF
• Pfam ID: PF03607
• Sequence:
  MSGSSARSSHLSQPVVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFG
  AVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQEAFKKLNYLDIGEIKKRPMEVVNTEVKPV
  IHSRINVSARFRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLR
  SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKASS
  LPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNS
  QETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDA
  EQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVN
  NELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA
• Function: Protein that plays a role in the inhibition of canonical Wnt signaling pathway. May be involved in neuronal migration during development of the cerebral neocortex. Involved in the control of ciliogenesis and ciliary length.
• Tissue Specificity: Ubiquitously expressed. In brain, highly expressed in the entorhinal cortex, inferior temporal cortex, medial temporal cortex, hypothalamus, amygdala and hippocampus . Expressed in liver by cholangiocytes, the epithelial cells of the bile ducts (at protein level) .

Molecular Interaction Atlas (MIA) of This DOT

52 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ciliopathy	DIS10G4I	Definitive	Autosomal recessive	[1]
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[2]
Nervous system disease	DISJ7GGT	Definitive	Biomarker	[3]
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[5]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[6]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[7]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[8]
Alzheimer disease	DISF8S70	Strong	Biomarker	[9]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[10]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Biomarker	[11]
Bladder cancer	DISUHNM0	Strong	Biomarker	[12]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[13]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[7]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[14]
Isolated neonatal sclerosing cholangitis	DIS6G5UY	Strong	Autosomal recessive	[15]
Language disorder	DISTLKP7	Strong	Genetic Variation	[16]
leukaemia	DISS7D1V	Strong	Biomarker	[17]
Leukemia	DISNAKFL	Strong	Biomarker	[18]
Lung cancer	DISCM4YA	Strong	Altered Expression	[19]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[19]
Lung neoplasm	DISVARNB	Strong	Biomarker	[20]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[21]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[22]
Neoplasm	DISZKGEW	Strong	Biomarker	[23]
Nephronophthisis	DISXU4HY	Strong	Genetic Variation	[24]
Nephronophthisis 19	DISKQRGA	Strong	Autosomal recessive	[25]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[26]
Obesity	DIS47Y1K	Strong	Biomarker	[27]
Parkinson disease	DISQVHKL	Strong	Biomarker	[28]
Prostate cancer	DISF190Y	Strong	Biomarker	[29]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[29]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[30]
Schizophrenia	DISSRV2N	Strong	Biomarker	[31]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[32]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[12]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[12]
Cardiovascular disease	DIS2IQDX	moderate	Genetic Variation	[33]
Colon cancer	DISVC52G	moderate	Biomarker	[34]
Colon carcinoma	DISJYKUO	moderate	Biomarker	[34]
Hearing loss, autosomal recessive	DIS8G9R9	Supportive	Autosomal recessive	[35]
Senior-Boichis syndrome	DISQ4EJN	Supportive	Autosomal recessive	[15]
Autosomal recessive nonsyndromic hearing loss 66	DISBYEVE	Limited	Autosomal recessive	[25]
Breast cancer	DIS7DPX1	Limited	Biomarker	[36]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[36]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[37]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[38]
Nonsyndromic genetic hearing loss	DISZX61P	Limited	Autosomal recessive	[1]
Plasma cell myeloma	DIS0DFZ0	Limited	Biomarker	[39]
Pneumonia	DIS8EF3M	Limited	Biomarker	[40]
Stroke	DISX6UHX	Limited	Biomarker	[41]
Triple negative breast cancer	DISAMG6N	Limited	Genetic Variation	[36]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[42]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[43]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[44]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[45]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[46]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[47]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[48]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Doublecortin domain-containing protein 2 (DCDC2).	[49]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[50]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[51]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[52]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[53]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[54]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Doublecortin domain-containing protein 2 (DCDC2).	[55]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide affects the expression of Doublecortin domain-containing protein 2 (DCDC2).	[56]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Doublecortin domain-containing protein 2 (DCDC2).	[57]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Doublecortin domain-containing protein 2 (DCDC2).	[58]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Ruthenium Complexes Induce HepG2 Human Hepatocellular Carcinoma Cell Apoptosis and Inhibit Cell Migration and Invasion through Regulation of the Nrf2 Pathway.Int J Mol Sci. 2016 May 19;17(5):775. doi: 10.3390/ijms17050775.
• [3] Derivation of primitive neural stem cells from human-induced pluripotent stem cells.J Comp Neurol. 2019 Dec 15;527(18):3023-3033. doi: 10.1002/cne.24727. Epub 2019 Jun 20.
• [4] The effect of diabetes on tooth loss caused by periodontal disease: A nationwide population-based cohort study in South Korea.J Periodontol. 2019 Jun;90(6):576-583. doi: 10.1002/JPER.18-0480. Epub 2019 Mar 12.
• [5] Targeted inhibition of STAT/TET1 axis as a therapeutic strategy for acute myeloid leukemia.Nat Commun. 2017 Dec 13;8(1):2099. doi: 10.1038/s41467-017-02290-w.
• [6] First-line chemotherapy regimens for locally advanced and metastatic pancreatic adenocarcinoma: a Bayesian analysis.Cancer Manag Res. 2018 Nov 20;10:5965-5978. doi: 10.2147/CMAR.S162980. eCollection 2018.
• [7] Repositioning of the antipsychotic trifluoperazine: Synthesis, biological evaluation and in silico study of trifluoperazine analogs as anti-glioblastoma agents.Eur J Med Chem. 2018 May 10;151:186-198. doi: 10.1016/j.ejmech.2018.03.055. Epub 2018 Mar 23.
• [8] Photochemical property of two Ru(II) compounds based on 5-(2-pyrazinyl)tetrazole for cancer phototherapy by changing auxiliary ligand.J Inorg Biochem. 2019 Apr;193:124-129. doi: 10.1016/j.jinorgbio.2019.01.015. Epub 2019 Jan 28.
• [9] Human neural stem cells improve cognition and promote synaptic growth in two complementary transgenic models of Alzheimer's disease and neuronal loss.Hippocampus. 2015 Jul;25(7):813-26. doi: 10.1002/hipo.22405. Epub 2015 Jan 8.
• [10] Primary Neurons and Differentiated NSC-34 Cells Are More Susceptible to Arginine-Rich ALS Dipeptide Repeat Protein-Associated Toxicity than Non-Differentiated NSC-34 and CHO Cells.Int J Mol Sci. 2019 Dec 11;20(24):6238. doi: 10.3390/ijms20246238.
• [11] Genetic association study of dyslexia and ADHD candidate genes in a Spanish cohort: Implications of comorbid samples.PLoS One. 2018 Oct 31;13(10):e0206431. doi: 10.1371/journal.pone.0206431. eCollection 2018.
• [12] Use of yeast chemigenomics and COXEN informatics in preclinical evaluation of anticancer agents.Neoplasia. 2011 Jan;13(1):72-80. doi: 10.1593/neo.101214.
• [13] In vitro and in vivo evaluations of the tyrosine kinase inhibitor NSC 680410 against human leukemia and glioblastoma cell lines.Cancer Chemother Pharmacol. 2002 Dec;50(6):479-89. doi: 10.1007/s00280-002-0507-6. Epub 2002 Oct 17.
• [14] A screen for novel hepatitis C virus RdRp inhibitor identifies a broad-spectrum antiviral compound.Sci Rep. 2017 Jul 19;7(1):5816. doi: 10.1038/s41598-017-04449-3.
• [15] DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling. Am J Hum Genet. 2015 Jan 8;96(1):81-92. doi: 10.1016/j.ajhg.2014.12.002. Epub 2014 Dec 31.
• [16] The regulatory element READ1 epistatically influences reading and language, with both deleterious and protective alleles.J Med Genet. 2016 Mar;53(3):163-71. doi: 10.1136/jmedgenet-2015-103418. Epub 2015 Dec 11.
• [17] Anti-leukemia activity of NSC-743380 in SULT1A1-expressing acute myeloid leukemia cells is associated with inhibitions of cFLIP expression and PI3K/AKT/mTOR activities.Oncotarget. 2017 Nov 1;8(60):102150-102160. doi: 10.18632/oncotarget.22235. eCollection 2017 Nov 24.
• [18] From Anthramycin to Pyrrolobenzodiazepine (PBD)-Containing Antibody-Drug Conjugates (ADCs).Angew Chem Int Ed Engl. 2017 Jan 9;56(2):462-488. doi: 10.1002/anie.201510610. Epub 2016 Nov 15.
• [19] New therapeutic perspectives in CCDC6 deficient lung cancer cells.Int J Cancer. 2015 May 1;136(9):2146-57. doi: 10.1002/ijc.29263. Epub 2014 Oct 24.
• [20] Hydrolysis reaction promotes changes in coordination mode of Ru(II)/acylthiourea organometallic complexes with cytotoxicity against human lung tumor cell lines.J Inorg Biochem. 2018 Sep;186:147-156. doi: 10.1016/j.jinorgbio.2018.06.007. Epub 2018 Jun 18.
• [21] Genome-wide association study of depression phenotypes in UK Biobank identifies variants in excitatory synaptic pathways.Nat Commun. 2018 Apr 16;9(1):1470. doi: 10.1038/s41467-018-03819-3.
• [22] Identification of campath-1 (CD52) as novel drug target in neoplastic stem cells in 5q-patients with MDS and AML.Clin Cancer Res. 2014 Jul 1;20(13):3589-602. doi: 10.1158/1078-0432.CCR-13-2811. Epub 2014 May 5.
• [23] Synthesis, Characterization, and Inducing Tumor Cell Apoptosis of Two Ru(II) Complexes Containing Guanidinium as Ligands.Anticancer Agents Med Chem. 2018;18(1):110-120. doi: 10.2174/1871520617666170419122056.
• [24] Nephronophthisis due to a novel DCDC2 variant in a patient from African-Caribbean descent: A case report.Am J Med Genet A. 2020 Mar;182(3):527-531. doi: 10.1002/ajmg.a.61440. Epub 2019 Dec 10.
• [25] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [26] Anticancer activity and mechanism of bis-pyrimidine based dimetallic Ru(II)((6)-p-cymene) complex in human non-small cell lung cancer via p53-dependent pathway.J Inorg Biochem. 2019 May;194:52-64. doi: 10.1016/j.jinorgbio.2019.01.019. Epub 2019 Feb 23.
• [27] Laminar inflammatory events in lean and obese ponies subjected to high carbohydrate feeding: Implications for pasture-associated laminitis.Equine Vet J. 2015 Jul;47(4):489-93. doi: 10.1111/evj.12314. Epub 2014 Sep 10.
• [28] The protective effect of human platelet lysate in models of neurodegenerative disease: involvement of the Akt and MEK pathways.J Tissue Eng Regen Med. 2017 Nov;11(11):3236-3240. doi: 10.1002/term.2222. Epub 2016 Dec 12.
• [29] Antitumour and Toxicity Evaluation of a Ru(II)-Cyclopentadienyl Complex in a Prostate Cancer Model by Imaging Tools.Anticancer Agents Med Chem. 2019;19(10):1262-1275. doi: 10.2174/1871520619666190318152726.
• [30] Aberrant expression of the neuronal-specific protein DCDC2 promotes malignant phenotypes and is associated with prostate cancer progression.Oncogene. 2013 May 2;32(18):2315-24, 2324.e1-4. doi: 10.1038/onc.2012.245. Epub 2012 Jun 25.
• [31] Genetic influences of cortical gray matter in language-related regions in healthy controls and schizophrenia.Schizophr Res. 2011 Jul;129(2-3):141-8. doi: 10.1016/j.schres.2011.03.027. Epub 2011 Apr 20.
• [32] The novel sequence-specific DNA cross-linking agent SJG-136 (NSC 694501) has potent and selective in vitro cytotoxicity in human B-cell chronic lymphocytic leukemia cells with evidence of a p53-independent mechanism of cell kill.Cancer Res. 2004 Sep 15;64(18):6750-5. doi: 10.1158/0008-5472.CAN-04-1713.
• [33] Risk of cerebro- and cardiovascular disease in patients with scrub typhus.Eur J Clin Microbiol Infect Dis. 2020 Mar;39(3):451-454. doi: 10.1007/s10096-019-03743-4. Epub 2019 Nov 27.
• [34] Ru(II)-thymine complex causes DNA damage and apoptotic cell death in human colon carcinoma HCT116 cells mediated by JNK/p38/ERK1/2 via a p53-independent signaling.Sci Rep. 2019 Jul 31;9(1):11094. doi: 10.1038/s41598-019-47539-0.
• [35] A missense mutation in DCDC2 causes human recessive deafness DFNB66, likely by interfering with sensory hair cell and supporting cell cilia length regulation. Hum Mol Genet. 2015 May 1;24(9):2482-91. doi: 10.1093/hmg/ddv009. Epub 2015 Jan 18.
• [36] Half-sandwich Ru((6)-p-cymene) complexes featuring pyrazole appended ligands: Synthesis, DNA binding and in vitro cytotoxicity.J Inorg Biochem. 2019 May;194:74-84. doi: 10.1016/j.jinorgbio.2019.02.012. Epub 2019 Feb 23.
• [37] Mortality of patients with chronic obstructive pulmonary disease: a nationwide populationbased cohort study.Korean J Intern Med. 2019 Nov;34(6):1272-1278. doi: 10.3904/kjim.2017.428. Epub 2019 Oct 16.
• [38] Prohibitin plays a critical role in Enterovirus 71 neuropathogenesis.PLoS Pathog. 2018 Jan 11;14(1):e1006778. doi: 10.1371/journal.ppat.1006778. eCollection 2018 Jan.
• [39] A phase II trial of BAY 43-9006 (sorafenib) (NSC-724772) in patients with relapsing and resistant multiple myeloma: SWOG S0434.Cancer Med. 2014 Oct;3(5):1275-83. doi: 10.1002/cam4.276. Epub 2014 Jun 10.
• [40] Epithelial Sodium Channel- Mediates the Protective Effect of the TNF-Derived TIP Peptide in Pneumolysin-Induced Endothelial Barrier Dysfunction.Front Immunol. 2017 Jul 21;8:842. doi: 10.3389/fimmu.2017.00842. eCollection 2017.
• [41] Human Neural Stem Cell Extracellular Vesicles Improve Recovery in a Porcine Model of Ischemic Stroke.Stroke. 2018 May;49(5):1248-1256. doi: 10.1161/STROKEAHA.117.020353. Epub 2018 Apr 12.
• [42] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [43] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [44] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [45] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [46] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [47] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [48] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [49] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [50] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [51] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [52] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [53] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [54] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [55] BET bromodomain inhibitors suppress EWS-FLI1-dependent transcription and the IGF1 autocrine mechanism in Ewing sarcoma. Oncotarget. 2016 Jul 12;7(28):43504-43517. doi: 10.18632/oncotarget.9762.
• [56] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [57] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [58] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.