Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVEBJ1V)

DOT Name Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1)
Synonyms Centrosomal leucine-rich repeat and coiled-coil domain-containing protein
Gene Name LRRCC1
Related Disease
Candidiasis ( )
Candidiasis, invasive ( )
HIV infectious disease ( )
Invasive candidiasis ( )
Oral candidiasis ( )
Vaginal infection ( )
Vulvovaginal Candidiasis ( )
Cutaneous candidiasis ( )
UniProt ID
LRCC1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12799
Sequence
MEAAAAVVAAEAEVENEDGDSSCGDVCFMDKGLQSISELSLDSTLHAVNLHCNNISKIEA
IDHIWNLQHLDLSSNQISRIEGLNTLTKLCTLNLSCNLITKVEGLEELINLTRLNVSYNH
IDDLSGLIPLHGIKHKLRYIDLHSNRIDSIHHLLQCMVGLHFLTNLILEKDGDDNPVCRL
PGYRAVILQTLPQLRILDCKNIFGEPVNLTEINSSQLQCLEGLLDNLVSSDSPLNISEDE
IIDRMPVITAPIDELVPLEQFASTPSDAVLTSFMSVCQSSEPEKNNHENDLQNEIKLQKL
DDQILQLLNETSNSIDNVLEKDPRPKRDTDITSESDYGNRKECNRKVPRRSKIPYDAKTI
QTIKHHNKNYNSFVSCNRKMKPPYLKELYVSSSLANCPMLQESEKPKTEIIKVDQSHSED
NTYQSLVEQLDQEREKRWRAEQAENKLMDYIDELHKHANEKEDIHSLALLTTDRLKEIIF
RERNSKGQLEVMVHKLQNEIKKLTVELMKAKDQQEDHLKHLRTLEKTLEKMERQKRQQQA
AQIRLIQEVELKASAADREIYLLRTSLHREREQAQQLHQLLALKEQEHRKELETREFFTD
ADFQDALAKEIAKEEKKHEQMIKEYQEKIDVLSQQYMDLENEFRIALTVEARRFQDVKDG
FENVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQ
INTLEILIEDDKQKSIQIELLKHEKVQLISELAAKESLIFGLRTERKVWGHELAQQGSSL
AQNRGKLEAQIESLSRENECLRKTNESDSDALRIKCKIIDDQTETIRKLKDCLQEKDEHI
KRLQEKITEIEKCTQEQLDEKSSQLDEVLEKLERHNERKEKLKQQLKGKEVELEEIRKAY
STLNRKWHDKGELLCHLETQVKEVKEKFENKEKKLKAERDKSIELQKNAMEKLHSMDDAF
KRQVDAIVEAHQAEIAQLANEKQKCIDSANLKVHQIEKEMRELLEETCKNKKTMEAKIKQ
LAFALNEIQQDM
Function Required for the organization of the mitotic spindle. Maintains the structural integrity of centrosomes during mitosis.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Candidiasis DISIRYMU Strong Biomarker [1]
Candidiasis, invasive DIS5VDG3 Strong Biomarker [2]
HIV infectious disease DISO97HC Strong Biomarker [3]
Invasive candidiasis DIS5EI0L Strong Biomarker [2]
Oral candidiasis DISAVKAH Strong Altered Expression [4]
Vaginal infection DISVXFB7 Strong Biomarker [5]
Vulvovaginal Candidiasis DISRCR6D Strong Altered Expression [6]
Cutaneous candidiasis DIS2U1JN Limited Biomarker [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [8]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [9]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [10]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [11]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [12]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [13]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [15]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [16]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [17]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [18]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1). [14]
------------------------------------------------------------------------------------

References

1 Silver-loaded graphene as an effective SERS substrate for clotrimazole detection: DFT and spectroscopic studies.Spectrochim Acta A Mol Biomol Spectrosc. 2018 Aug 5;201:354-361. doi: 10.1016/j.saa.2018.05.018. Epub 2018 May 7.
2 The use of hybrid phage displaying antigen epitope and recombinant protein in the diagnosis of systemic Candida albicans infection in rabbits and cancer patients.Diagn Microbiol Infect Dis. 2010 Dec;68(4):382-9. doi: 10.1016/j.diagmicrobio.2010.07.009. Epub 2010 Sep 29.
3 Elevated aspartic proteinase secretion and experimental pathogenicity of Candida albicans isolates from oral cavities of subjects infected with human immunodeficiency virus.Infect Immun. 1996 Feb;64(2):466-71. doi: 10.1128/iai.64.2.466-471.1996.
4 Genotyping of Candidaalbicans isolates from oropharyngeal candidiasis in head and neck cancer patients in Iran: Molecular epidemiology and SAP2 gene expression.J Mycol Med. 2019 Dec;29(4):310-316. doi: 10.1016/j.mycmed.2019.100896. Epub 2019 Sep 11.
5 The secreted aspartyl proteinases Sap1 and Sap2 cause tissue damage in an in vitro model of vaginal candidiasis based on reconstituted human vaginal epithelium.Infect Immun. 2003 Jun;71(6):3227-34. doi: 10.1128/IAI.71.6.3227-3234.2003.
6 Differential expression of Candida albicans secreted aspartyl proteinase in human vulvovaginal candidiasis.Mycoses. 2007 Sep;50(5):383-90. doi: 10.1111/j.1439-0507.2007.01384.x.
7 Invasion of Candida albicans correlates with expression of secreted aspartic proteinases during experimental infection of human epidermis.J Invest Dermatol. 2000 Apr;114(4):712-7. doi: 10.1046/j.1523-1747.2000.00935.x.
8 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
9 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
10 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
11 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
12 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
13 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
14 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
15 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
16 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
17 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
18 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
19 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.