General Information of Drug Off-Target (DOT) (ID: OTXQ51E0)

DOT Name F-box-like/WD repeat-containing protein TBL1X (TBL1X)
Synonyms SMAP55; Transducin beta-like protein 1X; Transducin-beta-like protein 1, X-linked
Gene Name TBL1X
Related Disease
Hypothyroidism, congenital, nongoitrous, 8 ( )
UniProt ID
TBL1X_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2XTC; 2XTD; 2XTE
Pfam ID
PF08513 ; PF00400
Sequence
MTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVN
FLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINED
GTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSA
GVSHQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVEIPSSKATVLRGHESEVFICAW
NPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNG
TLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHT
GEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKW
DPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLAS
ASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLV
HSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Function
F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange.
Tissue Specificity Ubiquitous.
KEGG Pathway
Wnt sig.ling pathway (hsa04310 )
Reactome Pathway
BMAL1 (R-HSA-1368108 )
PPARA activates gene expression (R-HSA-1989781 )
NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947 )
Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168 )
Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606 )
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862 )
HDACs deacetylate histones (R-HSA-3214815 )
Notch-HLH transcription pathway (R-HSA-350054 )
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
Regulation of lipid metabolism by PPARalpha (R-HSA-400206 )
Circadian Clock (R-HSA-400253 )
Loss of MECP2 binding ability to the NCoR/SMRT complex (R-HSA-9022537 )
Regulation of MECP2 expression and activity (R-HSA-9022692 )
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux (R-HSA-9029569 )
HCMV Early Events (R-HSA-9609690 )
Cytoprotection by HMOX1 (R-HSA-9707564 )
Heme signaling (R-HSA-9707616 )
RORA activates gene expression (R-HSA-1368082 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hypothyroidism, congenital, nongoitrous, 8 DISYPNF7 Limited Unknown [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [17]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [19]
------------------------------------------------------------------------------------
21 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [8]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [9]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [10]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [11]
Selenium DM25CGV Approved Selenium decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [12]
Bortezomib DMNO38U Approved Bortezomib increases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [13]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [14]
Aspirin DM672AH Approved Aspirin decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [15]
Rigosertib DMOSTXF Phase 3 Rigosertib increases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [16]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [12]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [18]
PMID27336223-Compound-5 DM6E50A Patented PMID27336223-Compound-5 decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [14]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [20]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [21]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [22]
AM251 DMTAWHL Investigative AM251 increases the expression of F-box-like/WD repeat-containing protein TBL1X (TBL1X). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Drug(s)

References

1 Mutations in TBL1X Are Associated With Central Hypothyroidism. J Clin Endocrinol Metab. 2016 Dec;101(12):4564-4573. doi: 10.1210/jc.2016-2531. Epub 2016 Sep 7.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
5 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
10 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
11 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
12 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
13 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
14 PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
15 Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
16 ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
18 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
19 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
20 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
21 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
22 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
23 Cannabinoid derivatives induce cell death in pancreatic MIA PaCa-2 cells via a receptor-independent mechanism. FEBS Lett. 2006 Mar 20;580(7):1733-9.