General Information of Drug Off-Target (DOT) (ID: OTZJ0CZK)

DOT Name CTD small phosphatase-like protein (CTDSPL)
Synonyms
CTDSP-like; EC 3.1.3.16; Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3; NIF-like protein; Nuclear LIM interactor-interacting factor 1; NLI-interacting factor 1; Protein YA22; hYA22; RBSP3; Small C-terminal domain phosphatase 3; SCP3; Small CTD phosphatase 3
Gene Name CTDSPL
Related Disease
Prostate cancer ( )
Prostate carcinoma ( )
Acute monocytic leukemia ( )
Advanced cancer ( )
Breast carcinoma ( )
Cervical cancer ( )
Cervical carcinoma ( )
Cervical Intraepithelial neoplasia ( )
Clear cell renal carcinoma ( )
Head-neck squamous cell carcinoma ( )
Lung neoplasm ( )
Myeloid leukaemia ( )
Non-small-cell lung cancer ( )
Periodontal disease ( )
Progressive multifocal leukoencephalopathy ( )
Squamous cell carcinoma ( )
Uveal Melanoma ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
Acute myelogenous leukaemia ( )
Adenocarcinoma ( )
Colon cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphoid leukemia ( )
Neoplasm ( )
UniProt ID
CTDSL_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2HHL
EC Number
3.1.3.16
Pfam ID
PF03031
Sequence
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPP
SSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHS
SFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVAD
LLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQS
WFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR
Function
Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells. Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation.
Tissue Specificity Expression is restricted to non-neuronal tissues.

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Prostate cancer DISF190Y Definitive Biomarker [1]
Prostate carcinoma DISMJPLE Definitive Biomarker [1]
Acute monocytic leukemia DIS28NEL Strong Altered Expression [2]
Advanced cancer DISAT1Z9 Strong Biomarker [3]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Cervical cancer DISFSHPF Strong Altered Expression [5]
Cervical carcinoma DIST4S00 Strong Altered Expression [5]
Cervical Intraepithelial neoplasia DISXP757 Strong Genetic Variation [6]
Clear cell renal carcinoma DISBXRFJ Strong Altered Expression [7]
Head-neck squamous cell carcinoma DISF7P24 Strong Genetic Variation [8]
Lung neoplasm DISVARNB Strong Altered Expression [9]
Myeloid leukaemia DISMN944 Strong Altered Expression [2]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [10]
Periodontal disease DISJQHVN Strong Biomarker [11]
Progressive multifocal leukoencephalopathy DISX02WS Strong Altered Expression [7]
Squamous cell carcinoma DISQVIFL Strong Biomarker [12]
Uveal Melanoma DISA7ZGL Strong Biomarker [13]
Thyroid cancer DIS3VLDH moderate Biomarker [14]
Thyroid gland carcinoma DISMNGZ0 moderate Biomarker [14]
Thyroid tumor DISLVKMD moderate Biomarker [14]
Acute myelogenous leukaemia DISCSPTN Limited Biomarker [15]
Adenocarcinoma DIS3IHTY Limited Posttranslational Modification [16]
Colon cancer DISVC52G Limited Biomarker [17]
Lung cancer DISCM4YA Limited Posttranslational Modification [16]
Lung carcinoma DISTR26C Limited Genetic Variation [16]
Lymphoid leukemia DIS65TYQ Limited Posttranslational Modification [17]
Neoplasm DISZKGEW Limited Biomarker [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 27 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Mitomycin DMH0ZJE Approved CTD small phosphatase-like protein (CTDSPL) affects the response to substance of Mitomycin. [35]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of CTD small phosphatase-like protein (CTDSPL). [18]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of CTD small phosphatase-like protein (CTDSPL). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of CTD small phosphatase-like protein (CTDSPL). [31]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of CTD small phosphatase-like protein (CTDSPL). [33]
------------------------------------------------------------------------------------
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of CTD small phosphatase-like protein (CTDSPL). [19]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of CTD small phosphatase-like protein (CTDSPL). [20]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of CTD small phosphatase-like protein (CTDSPL). [21]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of CTD small phosphatase-like protein (CTDSPL). [22]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of CTD small phosphatase-like protein (CTDSPL). [24]
Progesterone DMUY35B Approved Progesterone increases the expression of CTD small phosphatase-like protein (CTDSPL). [25]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of CTD small phosphatase-like protein (CTDSPL). [26]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of CTD small phosphatase-like protein (CTDSPL). [27]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of CTD small phosphatase-like protein (CTDSPL). [28]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of CTD small phosphatase-like protein (CTDSPL). [29]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of CTD small phosphatase-like protein (CTDSPL). [30]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of CTD small phosphatase-like protein (CTDSPL). [32]
Arachidonic acid DMUOQZD Investigative Arachidonic acid decreases the expression of CTD small phosphatase-like protein (CTDSPL). [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 Identification of Novel Epigenetic Markers of Prostate Cancer by NotI-Microarray Analysis.Dis Markers. 2015;2015:241301. doi: 10.1155/2015/241301. Epub 2015 Sep 28.
2 Expression of serologically identified tumor antigens in acute leukemias.Leuk Res. 2003 Jul;27(7):655-60. doi: 10.1016/s0145-2126(02)00230-8.
3 Synaptonemal complex protein 3 is associated with lymphangiogenesis in non-small cell lung cancer patients with lymph node metastasis.J Transl Med. 2017 Jun 17;15(1):138. doi: 10.1186/s12967-017-1241-5.
4 Frequent alterations of hMLH1 and RBSP3/HYA22 at chromosomal 3p22.3 region in early and late-onset breast carcinoma: clinical and prognostic significance.Cancer Sci. 2008 Oct;99(10):1984-91. doi: 10.1111/j.1349-7006.2008.00952.x.
5 Control of PD-L1 expression by miR-140/142/340/383 and oncogenic activation of the OCT4-miR-18a pathway in cervical cancer.Oncogene. 2018 Sep;37(39):5257-5268. doi: 10.1038/s41388-018-0347-4. Epub 2018 May 31.
6 Association of P16-RBSP3 inactivation with phosphorylated RB1 overexpression in basal-parabasal layers of normal cervix unchanged during CACX development.Biochem J. 2016 Oct 1;473(19):3221-36. doi: 10.1042/BCJ20160323. Epub 2016 Jul 25.
7 SCP phosphatases suppress renal cell carcinoma by stabilizing PML and inhibiting mTOR/HIF signaling.Cancer Res. 2014 Dec 1;74(23):6935-46. doi: 10.1158/0008-5472.CAN-14-1330. Epub 2014 Oct 7.
8 Frequent alterations of the candidate genes hMLH1, ITGA9 and RBSP3 in early dysplastic lesions of head and neck: clinical and prognostic significance.Cancer Sci. 2010 Jun;101(6):1511-20. doi: 10.1111/j.1349-7006.2010.01551.x. Epub 2010 Feb 4.
9 [Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer].Mol Biol (Mosk). 2008 Nov-Dec;42(6):965-76.
10 Tumor suppressor properties of the small C-terminal domain phosphatases in non-small cell lung cancer.Biosci Rep. 2019 Dec 20;39(12):BSR20193094. doi: 10.1042/BSR20193094.
11 Effects of smoking and genotype on the PSR index of periodontal disease in adults aged 18-49.Int J Environ Res Public Health. 2012 Aug;9(8):2839-50. doi: 10.3390/ijerph9082839. Epub 2012 Aug 10.
12 Novel tumor suppressor candidates on chromosome 3 revealed by NotI-microarrays in cervical cancer.Epigenetics. 2013 Apr;8(4):409-20. doi: 10.4161/epi.24233. Epub 2013 Mar 11.
13 The miR-181 family promotes cell cycle by targeting CTDSPL, a phosphatase-like tumor suppressor in uveal melanoma.J Exp Clin Cancer Res. 2018 Jan 30;37(1):15. doi: 10.1186/s13046-018-0679-5.
14 Expression of miR-100 and RBSP3 in FTC-133 cells after exposure to 131I.Nucl Med Commun. 2014 Sep;35(9):932-8. doi: 10.1097/MNM.0000000000000142.
15 MiR-100 regulates cell differentiation and survival by targeting RBSP3, a phosphatase-like tumor suppressor in acute myeloid leukemia.Oncogene. 2012 Jan 5;31(1):80-92. doi: 10.1038/onc.2011.208. Epub 2011 Jun 6.
16 Simultaneous down-regulation of tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A in primary non-small cell lung cancer.BMC Cancer. 2010 Mar 1;10:75. doi: 10.1186/1471-2407-10-75.
17 Silencing of bidirectional promoters by DNA methylation in tumorigenesis.Cancer Res. 2006 May 15;66(10):5077-84. doi: 10.1158/0008-5472.CAN-05-2629.
18 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
19 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
20 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
21 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
22 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
23 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
24 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
25 Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
26 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
27 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
28 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
29 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
30 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
31 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
32 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
33 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
34 Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
35 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.