Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZJ0CZK)

• DOT Name: CTD small phosphatase-like protein (CTDSPL)
• Synonyms: CTDSP-like; EC 3.1.3.16; Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3; NIF-like protein; Nuclear LIM interactor-interacting factor 1; NLI-interacting factor 1; Protein YA22; hYA22; RBSP3; Small C-terminal domain phosphatase 3; SCP3; Small CTD phosphatase 3
• Gene Name: CTDSPL
• Related Disease:
  Prostate cancer
  Prostate carcinoma
  Acute monocytic leukemia
  Advanced cancer
  Breast carcinoma
  Cervical cancer
  Cervical carcinoma
  Cervical Intraepithelial neoplasia
  Clear cell renal carcinoma
  Head-neck squamous cell carcinoma
  Lung neoplasm
  Myeloid leukaemia
  Non-small-cell lung cancer
  Periodontal disease
  Progressive multifocal leukoencephalopathy
  Squamous cell carcinoma
  Uveal Melanoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Acute myelogenous leukaemia
  Adenocarcinoma
  Colon cancer
  Lung cancer
  Lung carcinoma
  Lymphoid leukemia
  Neoplasm
• UniProt ID: CTDSL_HUMAN
• PDB ID: 2HHL
• EC Number: 3.1.3.16
• Pfam ID: PF03031
• Sequence:
  MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPP
  SSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHS
  SFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVAD
  LLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQS
  WFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR
• Function: Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells. Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation.
• Tissue Specificity: Expression is restricted to non-neuronal tissues.

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Definitive	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[1]
Acute monocytic leukemia	DIS28NEL	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[5]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[5]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Genetic Variation	[6]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[7]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Genetic Variation	[8]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[9]
Myeloid leukaemia	DISMN944	Strong	Altered Expression	[2]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[10]
Periodontal disease	DISJQHVN	Strong	Biomarker	[11]
Progressive multifocal leukoencephalopathy	DISX02WS	Strong	Altered Expression	[7]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[12]
Uveal Melanoma	DISA7ZGL	Strong	Biomarker	[13]
Thyroid cancer	DIS3VLDH	moderate	Biomarker	[14]
Thyroid gland carcinoma	DISMNGZ0	moderate	Biomarker	[14]
Thyroid tumor	DISLVKMD	moderate	Biomarker	[14]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[15]
Adenocarcinoma	DIS3IHTY	Limited	Posttranslational Modification	[16]
Colon cancer	DISVC52G	Limited	Biomarker	[17]
Lung cancer	DISCM4YA	Limited	Posttranslational Modification	[16]
Lung carcinoma	DISTR26C	Limited	Genetic Variation	[16]
Lymphoid leukemia	DIS65TYQ	Limited	Posttranslational Modification	[17]
Neoplasm	DISZKGEW	Limited	Biomarker	[13]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	CTD small phosphatase-like protein (CTDSPL) affects the response to substance of Mitomycin.	[35]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of CTD small phosphatase-like protein (CTDSPL).	[18]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of CTD small phosphatase-like protein (CTDSPL).	[23]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of CTD small phosphatase-like protein (CTDSPL).	[31]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of CTD small phosphatase-like protein (CTDSPL).	[33]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of CTD small phosphatase-like protein (CTDSPL).	[19]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of CTD small phosphatase-like protein (CTDSPL).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of CTD small phosphatase-like protein (CTDSPL).	[21]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of CTD small phosphatase-like protein (CTDSPL).	[22]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of CTD small phosphatase-like protein (CTDSPL).	[24]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of CTD small phosphatase-like protein (CTDSPL).	[25]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of CTD small phosphatase-like protein (CTDSPL).	[26]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of CTD small phosphatase-like protein (CTDSPL).	[27]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of CTD small phosphatase-like protein (CTDSPL).	[28]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of CTD small phosphatase-like protein (CTDSPL).	[29]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of CTD small phosphatase-like protein (CTDSPL).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of CTD small phosphatase-like protein (CTDSPL).	[32]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid decreases the expression of CTD small phosphatase-like protein (CTDSPL).	[34]

References

• [1] Identification of Novel Epigenetic Markers of Prostate Cancer by NotI-Microarray Analysis.Dis Markers. 2015;2015:241301. doi: 10.1155/2015/241301. Epub 2015 Sep 28.
• [2] Expression of serologically identified tumor antigens in acute leukemias.Leuk Res. 2003 Jul;27(7):655-60. doi: 10.1016/s0145-2126(02)00230-8.
• [3] Synaptonemal complex protein 3 is associated with lymphangiogenesis in non-small cell lung cancer patients with lymph node metastasis.J Transl Med. 2017 Jun 17;15(1):138. doi: 10.1186/s12967-017-1241-5.
• [4] Frequent alterations of hMLH1 and RBSP3/HYA22 at chromosomal 3p22.3 region in early and late-onset breast carcinoma: clinical and prognostic significance.Cancer Sci. 2008 Oct;99(10):1984-91. doi: 10.1111/j.1349-7006.2008.00952.x.
• [5] Control of PD-L1 expression by miR-140/142/340/383 and oncogenic activation of the OCT4-miR-18a pathway in cervical cancer.Oncogene. 2018 Sep;37(39):5257-5268. doi: 10.1038/s41388-018-0347-4. Epub 2018 May 31.
• [6] Association of P16-RBSP3 inactivation with phosphorylated RB1 overexpression in basal-parabasal layers of normal cervix unchanged during CACX development.Biochem J. 2016 Oct 1;473(19):3221-36. doi: 10.1042/BCJ20160323. Epub 2016 Jul 25.
• [7] SCP phosphatases suppress renal cell carcinoma by stabilizing PML and inhibiting mTOR/HIF signaling.Cancer Res. 2014 Dec 1;74(23):6935-46. doi: 10.1158/0008-5472.CAN-14-1330. Epub 2014 Oct 7.
• [8] Frequent alterations of the candidate genes hMLH1, ITGA9 and RBSP3 in early dysplastic lesions of head and neck: clinical and prognostic significance.Cancer Sci. 2010 Jun;101(6):1511-20. doi: 10.1111/j.1349-7006.2010.01551.x. Epub 2010 Feb 4.
• [9] [Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer].Mol Biol (Mosk). 2008 Nov-Dec;42(6):965-76.
• [10] Tumor suppressor properties of the small C-terminal domain phosphatases in non-small cell lung cancer.Biosci Rep. 2019 Dec 20;39(12):BSR20193094. doi: 10.1042/BSR20193094.
• [11] Effects of smoking and genotype on the PSR index of periodontal disease in adults aged 18-49.Int J Environ Res Public Health. 2012 Aug;9(8):2839-50. doi: 10.3390/ijerph9082839. Epub 2012 Aug 10.
• [12] Novel tumor suppressor candidates on chromosome 3 revealed by NotI-microarrays in cervical cancer.Epigenetics. 2013 Apr;8(4):409-20. doi: 10.4161/epi.24233. Epub 2013 Mar 11.
• [13] The miR-181 family promotes cell cycle by targeting CTDSPL, a phosphatase-like tumor suppressor in uveal melanoma.J Exp Clin Cancer Res. 2018 Jan 30;37(1):15. doi: 10.1186/s13046-018-0679-5.
• [14] Expression of miR-100 and RBSP3 in FTC-133 cells after exposure to 131I.Nucl Med Commun. 2014 Sep;35(9):932-8. doi: 10.1097/MNM.0000000000000142.
• [15] MiR-100 regulates cell differentiation and survival by targeting RBSP3, a phosphatase-like tumor suppressor in acute myeloid leukemia.Oncogene. 2012 Jan 5;31(1):80-92. doi: 10.1038/onc.2011.208. Epub 2011 Jun 6.
• [16] Simultaneous down-regulation of tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A in primary non-small cell lung cancer.BMC Cancer. 2010 Mar 1;10:75. doi: 10.1186/1471-2407-10-75.
• [17] Silencing of bidirectional promoters by DNA methylation in tumorigenesis.Cancer Res. 2006 May 15;66(10):5077-84. doi: 10.1158/0008-5472.CAN-05-2629.
• [18] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [19] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [20] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [23] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [24] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [25] Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
• [26] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [27] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [28] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [29] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [30] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [31] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [32] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [33] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [34] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [35] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.