General Information of Drug (ID: DM58QS1)

Drug Name
Botulinum Toxin Type B
Synonyms BTXA (TN); Dysport (TN); Myobloc (TN); Neurobloc (TN); Xeomin (TN)
Indication
Disease Entry ICD 11 Status REF
Parkinson disease 8A00.0 Approved [1]
Therapeutic Class
Antidystonic Agents
Affected Organisms
Humans and other mammals
Sequence
MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFN
KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLG
DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH
FASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY
GIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIV
DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN
IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQA
YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSN
YIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQY
LYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND
FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI
PVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMY
KALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSV
SYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDL
SIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK
LTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS
GWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING
KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY
SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY
IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISD
SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCIS
KWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE
Cross-matching ID
UNII
0Y70779M1F
DrugBank ID
DB00042
TTD ID
D02FXK

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Vesicle-associated membrane protein (VAMP) TTG25NJ VAMP1_HUMAN ; VAMP2_HUMAN Binder [2]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Botulinum Toxin Type B
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Biperiden DME78OA Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Biperiden. Parkinsonism [8A00] [3]
Benztropine DMGZOVN Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Benztropine. Parkinsonism [8A00] [3]
Procyclidine DMHFJDT Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Procyclidine. Parkinsonism [8A00] [3]
Coadministration of a Drug Treating the Disease Different from Botulinum Toxin Type B (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Scopolamine DMOM8AL Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Scopolamine. Addictive disorder [6C50-6C5Z] [3]
Mepyramine DMB4SFH Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Mepyramine. Allergic/hypersensitivity disorder [4A80-4A8Z] [3]
Phenyltoloxamine DMKAEQW Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Phenyltoloxamine. Allergic/hypersensitivity disorder [4A80-4A8Z] [3]
Tripelennamine DMZBU15 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Tripelennamine. Allergic/hypersensitivity disorder [4A80-4A8Z] [3]
Hydroxyzine DMF8Y74 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Hydroxyzine. Anxiety disorder [6B00-6B0Z] [3]
Promazine DMZAL7W Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Promazine. Appearance/behaviour symptom [MB23] [3]
Desipramine DMT2FDC Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Desipramine. Attention deficit hyperactivity disorder [6A05] [3]
Imipramine DM2NUH3 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Imipramine. Depression [6A70-6A7Z] [3]
Nortriptyline DM4KDYJ Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Nortriptyline. Depression [6A70-6A7Z] [3]
Clomipramine DMINRKW Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Clomipramine. Depression [6A70-6A7Z] [3]
Amitriptyline DMK7F9S Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Amitriptyline. Depression [6A70-6A7Z] [3]
Amoxapine DMKITQE Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Amoxapine. Depression [6A70-6A7Z] [3]
Protriptyline DMNHTZI Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Protriptyline. Depression [6A70-6A7Z] [3]
Doxepin DMPI98T Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Doxepin. Depression [6A70-6A7Z] [3]
Maprotiline DMPWB7T Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Maprotiline. Depression [6A70-6A7Z] [3]
Hyoscyamine DM804UR Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Hyoscyamine. Digestive system disease [DE2Z] [3]
Mepenzolate DM8YU2F Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Mepenzolate. Digestive system disease [DE2Z] [3]
Oxybutynine DMJPBAX Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Oxybutynine. Discovery agent [N.A.] [3]
Meclizine DMS7T13 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Meclizine. Dizziness and giddiness [MB48] [3]
Trihexyphenidyl DMB19L8 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Trihexyphenidyl. Dystonic disorder [8A02] [3]
Diphenhydramine DMKQTBA Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Diphenhydramine. Episodic vestibular syndrome [AB31] [3]
Solifenacin DMG592Q Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Solifenacin. Functional bladder disorder [GC50] [3]
Tolterodine DMSHPW8 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Tolterodine. Functional bladder disorder [GC50] [3]
Darifenacin DMWXLYZ Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Darifenacin. Functional bladder disorder [GC50] [3]
Propantheline DM2EN6G Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Propantheline. Gastric ulcer [DA60] [3]
Propiomazine DMKY8V1 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Propiomazine. Insomnia [7A00-7A0Z] [3]
Clidinium DMUMQZ0 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Clidinium. Irritable bowel syndrome [DD91] [3]
Dicyclomine DMZSDGX Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Dicyclomine. Irritable bowel syndrome [DD91] [3]
Doxylamine DMKOXFE Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Doxylamine. Morning sickness disorder [SC00] [3]
Phenindamine DMDTC7R Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Phenindamine. Nasopharyngitis [CA00] [3]
Dimenhydrinate DM264B3 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Dimenhydrinate. Nausea/vomiting [MD90] [3]
Prochlorperazine DM53SRA Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Prochlorperazine. Nausea/vomiting [MD90] [3]
Promethazine DM6I5GR Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Promethazine. Nausea/vomiting [MD90] [3]
Cyclizine DM9G7BS Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Cyclizine. Nausea/vomiting [MD90] [3]
Thiethylperazine DMU3IET Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Thiethylperazine. Nausea/vomiting [MD90] [3]
Flavoxate DMKV4NL Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Flavoxate. Pain [MG30-MG3Z] [3]
Methylscopolamine DM5VWOB Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Methylscopolamine. Peptic ulcer [DA61] [3]
Levomepromazine DMIKFEL Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Levomepromazine. Psychotic disorder [6A20-6A25] [3]
Fluphenazine DMIT8LX Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Fluphenazine. Psychotic disorder [6A20-6A25] [3]
Triflupromazine DMKFQJP Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Triflupromazine. Psychotic disorder [6A20-6A25] [3]
Cyproheptadine DM92AH3 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Cyproheptadine. Rheumatoid arthritis [FA20] [3]
Mesoridazine DM2ZGAN Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Mesoridazine. Schizophrenia [6A20] [3]
Thioridazine DM35M8J Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Thioridazine. Schizophrenia [6A20] [3]
Loxapine DM8AI9U Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Loxapine. Schizophrenia [6A20] [3]
Perphenazine DMA4MRX Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Perphenazine. Schizophrenia [6A20] [3]
Molindone DMAH70G Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Molindone. Schizophrenia [6A20] [3]
Chlorpromazine DMBGZI3 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Chlorpromazine. Schizophrenia [6A20] [3]
Thiothixene DMDINC4 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Thiothixene. Schizophrenia [6A20] [3]
Clozapine DMFC71L Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Clozapine. Schizophrenia [6A20] [3]
Trifluoperazine DMKBYWI Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Trifluoperazine. Schizophrenia [6A20] [3]
Pimozide DMW83TP Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Pimozide. Schizophrenia [6A20] [3]
Trospium DMX6RTG Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Trospium. Tonus and reflex abnormality [MB47] [3]
Chlorpheniramine DM5URA2 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Chlorpheniramine. Vasomotor/allergic rhinitis [CA08] [3]
Triprolidine DM7SWIA Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Triprolidine. Vasomotor/allergic rhinitis [CA08] [3]
Methdilazine DMAUHQX Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Methdilazine. Vasomotor/allergic rhinitis [CA08] [3]
Clemastine DMBZWQL Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Clemastine. Vasomotor/allergic rhinitis [CA08] [3]
Carbinoxamine DMCT31R Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Carbinoxamine. Vasomotor/allergic rhinitis [CA08] [3]
Trimeprazine DMEMV9D Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Trimeprazine. Vasomotor/allergic rhinitis [CA08] [3]
Brompheniramine DMFOVSD Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Brompheniramine. Vasomotor/allergic rhinitis [CA08] [3]
Dexbrompheniramine DMKVWGE Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Dexbrompheniramine. Vasomotor/allergic rhinitis [CA08] [3]
Acrivastine DMTIGA0 Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Acrivastine. Vasomotor/allergic rhinitis [CA08] [3]
Azatadine DMZ80SB Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Azatadine. Vasomotor/allergic rhinitis [CA08] [3]
Disopyramide DM5SYZP Moderate Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Disopyramide. Ventricular tachyarrhythmia [BC71] [3]
⏷ Show the Full List of 63 DDI Information of This Drug

References

1 Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2 Long-lasting benefits of botulinum toxin type B in Parkinson's disease-related drooling. J Neurol. 2009 Apr;256(4):563-7.
3 Product Information. Botox (onabotulinumtoxin A). Allergan Inc, Irvine, CA.