Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0QHTAR)

• DOT Name: Glutaredoxin-1 (GLRX)
• Synonyms: Thioltransferase-1; TTase-1
• Gene Name: GLRX
• UniProt ID: GLRX1_HUMAN
• PDB ID: 1B4Q; 1JHB; 4RQR
• Pfam ID: PF00462
• Sequence:
  MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY
  LQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
• Function: Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
• Reactome Pathway: Interconversion of nucleotide di- and triphosphates (R-HSA-499943)
• BioCyc Pathway: MetaCyc:HS04268-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Glutaredoxin-1 (GLRX) decreases the response to substance of Doxorubicin.	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Glutaredoxin-1 (GLRX).	[1]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Glutaredoxin-1 (GLRX).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Glutaredoxin-1 (GLRX).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Glutaredoxin-1 (GLRX).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Glutaredoxin-1 (GLRX).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Glutaredoxin-1 (GLRX).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glutaredoxin-1 (GLRX).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Glutaredoxin-1 (GLRX).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Glutaredoxin-1 (GLRX).	[9]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Glutaredoxin-1 (GLRX).	[10]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Glutaredoxin-1 (GLRX).	[11]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Glutaredoxin-1 (GLRX).	[9]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Glutaredoxin-1 (GLRX).	[12]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Glutaredoxin-1 (GLRX).	[13]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Glutaredoxin-1 (GLRX).	[14]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Glutaredoxin-1 (GLRX).	[15]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Glutaredoxin-1 (GLRX).	[16]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Glutaredoxin-1 (GLRX).	[17]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Glutaredoxin-1 (GLRX).	[3]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Glutaredoxin-1 (GLRX).	[18]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Glutaredoxin-1 (GLRX).	[19]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Glutaredoxin-1 (GLRX).	[20]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Glutaredoxin-1 (GLRX).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Glutaredoxin-1 (GLRX).	[21]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Glutaredoxin-1 (GLRX).	[22]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Glutaredoxin-1 (GLRX).	[23]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Glutaredoxin-1 (GLRX).	[24]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Glutaredoxin-1 (GLRX).	[25]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Glutaredoxin-1 (GLRX).	[26]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Glutaredoxin-1 (GLRX).	[27]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Glutaredoxin-1 (GLRX).	[28]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Glutaredoxin-1 (GLRX).	[29]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [4] Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [10] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [11] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [12] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [13] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [14] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [15] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [16] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [17] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [18] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [19] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [20] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [21] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [22] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [23] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [24] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [25] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [26] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [27] Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
• [28] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [29] The glutaredoxin/glutathione system modulates NF-kappaB activity by glutathionylation of p65 in cinnamaldehyde-treated endothelial cells. Toxicol Sci. 2010 Jul;116(1):151-63. doi: 10.1093/toxsci/kfq098. Epub 2010 Mar 29.
• [30] A novel thiol oxidation-based mechanism for adriamycin-induced cell injury in human macrophages. FASEB J. 2005 Nov;19(13):1866-8. doi: 10.1096/fj.04-2991fje. Epub 2005 Sep 13.