Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0TFMFE)

DOT Name Cell adhesion molecule 4 (CADM4)
Synonyms Immunoglobulin superfamily member 4C; IgSF4C; Nectin-like protein 4; NECL-4; TSLC1-like protein 2
Gene Name CADM4
Related Disease
Adenocarcinoma ( )
Adult T-cell leukemia/lymphoma ( )
Charcot-Marie-Tooth disease type 1A ( )
Clear cell renal carcinoma ( )
Lung neoplasm ( )
Neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Signet ring cell carcinoma ( )
T-cell leukaemia ( )
Triple negative breast cancer ( )
Advanced cancer ( )
Glioma ( )
Matthew-Wood syndrome ( )
Metastatic malignant neoplasm ( )
Pancreatic ductal carcinoma ( )
UniProt ID
CADM4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF08205 ; PF13927 ; PF07686
Sequence
MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPA
RQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTV
LVAPENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSV
ASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDT
LVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHA
RALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVRQKGSYLTHEA
SGLDEQGEAREAFLNGSDGHKRKEEFFI
Function Involved in the cell-cell adhesion. Has calcium- and magnesium-independent cell-cell adhesion activity. May have tumor-suppressor activity.
Tissue Specificity Expressed in brain, prostate, brain, kidney and some other organs.

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adenocarcinoma DIS3IHTY Strong Altered Expression [1]
Adult T-cell leukemia/lymphoma DIS882XU Strong Biomarker [2]
Charcot-Marie-Tooth disease type 1A DISSRZG7 Strong Biomarker [3]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [4]
Lung neoplasm DISVARNB Strong Biomarker [5]
Neoplasm DISZKGEW Strong Altered Expression [6]
Prostate cancer DISF190Y Strong Biomarker [7]
Prostate carcinoma DISMJPLE Strong Biomarker [7]
Prostate neoplasm DISHDKGQ Strong Altered Expression [5]
Signet ring cell carcinoma DISVCUCR Strong Genetic Variation [1]
T-cell leukaemia DISJ6YIF Strong Biomarker [2]
Triple negative breast cancer DISAMG6N moderate Altered Expression [8]
Advanced cancer DISAT1Z9 Limited Biomarker [9]
Glioma DIS5RPEH Limited Altered Expression [10]
Matthew-Wood syndrome DISA7HR7 Limited Altered Expression [9]
Metastatic malignant neoplasm DIS86UK6 Limited Altered Expression [9]
Pancreatic ductal carcinoma DIS26F9Q Limited Altered Expression [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Cell adhesion molecule 4 (CADM4). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Cell adhesion molecule 4 (CADM4). [15]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Cell adhesion molecule 4 (CADM4). [12]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Cell adhesion molecule 4 (CADM4). [13]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Cell adhesion molecule 4 (CADM4). [14]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Cell adhesion molecule 4 (CADM4). [14]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Cell adhesion molecule 4 (CADM4). [16]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Cell adhesion molecule 4 (CADM4). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Loss of CADM4 expression is associated with poor prognosis in small intestinal adenocarcinomas.APMIS. 2017 May;125(5):437-443. doi: 10.1111/apm.12684.
2 Quantitative Analysis of Interaction Between CADM1 and Its Binding Cell-Surface Proteins Using Surface Plasmon Resonance Imaging.Front Cell Dev Biol. 2018 Aug 7;6:86. doi: 10.3389/fcell.2018.00086. eCollection 2018.
3 An essential role of MAG in mediating axon-myelin attachment in Charcot-Marie-Tooth 1A disease.Neurobiol Dis. 2013 Jan;49:221-31. doi: 10.1016/j.nbd.2012.08.009. Epub 2012 Aug 25.
4 Aberrations of a cell adhesion molecule CADM4 in renal clear cell carcinoma.Int J Cancer. 2012 Mar 15;130(6):1329-37. doi: 10.1002/ijc.26160. Epub 2011 Jul 21.
5 Cell adhesion and prostate tumor-suppressor activity of TSLL2/IGSF4C, an immunoglobulin superfamily molecule homologous to TSLC1/IGSF4.Oncogene. 2006 Mar 9;25(10):1446-53. doi: 10.1038/sj.onc.1209192.
6 Decreased expression of CADM1 and CADM4 are associated with advanced stage breast cancer.Oncol Lett. 2018 Feb;15(2):2401-2406. doi: 10.3892/ol.2017.7536. Epub 2017 Dec 6.
7 Hypoexpression and epigenetic regulation of candidate tumor suppressor gene CADM-2 in human prostate cancer.Clin Cancer Res. 2010 Nov 15;16(22):5390-401. doi: 10.1158/1078-0432.CCR-10-1461. Epub 2010 Nov 9.
8 Expression profile of CADM1 and CADM4 in triple negative breast cancer with primary systemic therapy.Oncol Lett. 2019 Jan;17(1):921-926. doi: 10.3892/ol.2018.9727. Epub 2018 Nov 19.
9 Clinicopathological significance of Necl-4 expression in pancreatic ductal adenocarcinoma.J Clin Pathol. 2017 Jul;70(7):619-624. doi: 10.1136/jclinpath-2016-204028. Epub 2016 Dec 15.
10 Isolation of the TSLL1 and TSLL2 genes, members of the tumor suppressor TSLC1 gene family encoding transmembrane proteins.Oncogene. 2001 Aug 30;20(38):5401-7. doi: 10.1038/sj.onc.1204696.
11 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
12 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
13 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
14 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
15 Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
16 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
17 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.