Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT12MSRY)

• DOT Name: M-phase inducer phosphatase 2 (CDC25B)
• Synonyms: EC 3.1.3.48; Dual specificity phosphatase Cdc25B
• Gene Name: CDC25B
• UniProt ID: MPIP2_HUMAN
• PDB ID: 1CWR; 1CWS; 1CWT; 1QB0; 1YM9; 1YMD; 1YMK; 1YML; 1YS0; 2A2K; 2IFD; 2IFV; 2UZQ; 3FQT; 3FQU; 4WH7; 4WH9
• EC Number: 3.1.3.48
• Pfam ID: PF06617 ; PF00581
• Sequence:
  MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
  DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
  PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
  GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
  RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
  LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
  QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
  VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
  VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
  DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
• Function: Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Directly dephosphorylates CDK1 and stimulates its kinase activity. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. The three isoforms seem to have a different level of activity.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  Cell cycle (hsa04110)
  Progesterone-mediated oocyte maturation (hsa04914)
  MicroR.s in cancer (hsa05206)
• Reactome Pathway:
  Cyclin A (R-HSA-69656)
  Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models (R-HSA-8862803)
  Cyclin A/B1/B2 associated events during G2/M transition (R-HSA-69273)

Molecular Interaction Atlas (MIA) of This DOT

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of M-phase inducer phosphatase 2 (CDC25B).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[7]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of M-phase inducer phosphatase 2 (CDC25B).	[8]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[9]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[9]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of M-phase inducer phosphatase 2 (CDC25B).	[10]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[11]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[12]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of M-phase inducer phosphatase 2 (CDC25B).	[13]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[14]
Simvastatin	DM30SGU	Approved	Simvastatin affects the expression of M-phase inducer phosphatase 2 (CDC25B).	[15]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of M-phase inducer phosphatase 2 (CDC25B).	[16]
Silymarin	DMXBYQR	Phase 4	Silymarin decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[17]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[18]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[19]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of M-phase inducer phosphatase 2 (CDC25B).	[20]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[21]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of M-phase inducer phosphatase 2 (CDC25B).	[22]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[24]
AT7519	DMCE08M	Phase 1	AT7519 decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[27]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of M-phase inducer phosphatase 2 (CDC25B).	[21]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of M-phase inducer phosphatase 2 (CDC25B).	[30]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde decreases the activity of M-phase inducer phosphatase 2 (CDC25B).	[31]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of M-phase inducer phosphatase 2 (CDC25B).	[23]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of M-phase inducer phosphatase 2 (CDC25B).	[25]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of M-phase inducer phosphatase 2 (CDC25B).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of M-phase inducer phosphatase 2 (CDC25B).	[29]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of M-phase inducer phosphatase 2 (CDC25B).	[28]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] FOXM1 is a transcriptional target of ERalpha and has a critical role in breast cancer endocrine sensitivity and resistance. Oncogene. 2010 May 20;29(20):2983-95. doi: 10.1038/onc.2010.47. Epub 2010 Mar 8.
• [7] Arsenic trioxide-mediated growth inhibition in MC/CAR myeloma cells via cell cycle arrest in association with induction of cyclin-dependent kinase inhibitor, p21, and apoptosis. Cancer Res. 2000 Jun 1;60(11):3065-71.
• [8] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [9] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [10] Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
• [11] Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery. Mol Cancer. 2006 May 18;5:20. doi: 10.1186/1476-4598-5-20.
• [12] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [13] Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
• [14] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [15] Temporal gene expression analysis of human coronary artery endothelial cells treated with Simvastatin. Gene Expr. 2008;14(4):229-39. doi: 10.3727/105221608786883834.
• [16] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [17] Identifying the differential effects of silymarin constituents on cell growth and cell cycle regulatory molecules in human prostate cancer cells. Int J Cancer. 2008 Jul 1;123(1):41-50. doi: 10.1002/ijc.23485.
• [18] Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
• [19] Molecular signatures of soy-derived phytochemicals in androgen-responsive prostate cancer cells: a comparison study using DNA microarray. Mol Carcinog. 2006 Dec;45(12):943-56.
• [20] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [21] Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
• [22] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [23] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [24] The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
• [25] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [26] CDK Blockade Using AT7519 Suppresses Acute Myeloid Leukemia Cell Survival through the Inhibition of Autophagy and Intensifies the Anti-leukemic Effect of Arsenic Trioxide. Iran J Pharm Res. 2019 Fall;18(Suppl1):119-131. doi: 10.22037/ijpr.2019.112560.13827.
• [27] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [28] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [29] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [30] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [31] Synthesis and biological evaluation of dimeric cinnamaldehydes as potent antitumor agents. Bioorg Med Chem. 2006 Apr 15;14(8):2498-506. doi: 10.1016/j.bmc.2005.11.028. Epub 2005 Dec 15.