Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1U4ZZW)

• DOT Name: Pregnancy-specific beta-1-glycoprotein 1 (PSG1)
• Synonyms: PS-beta-G-1; PSBG-1; Pregnancy-specific glycoprotein 1; CD66 antigen-like family member F; Fetal liver non-specific cross-reactive antigen 1/2; FL-NCA-1/2; PSG95; Pregnancy-specific beta-1 glycoprotein C/D; PS-beta-C/D; CD antigen CD66f
• Gene Name: PSG1
• Related Disease:
  Type-1 diabetes
  Acute graft versus host disease
  Advanced cancer
  Autoimmune disease
  Frontotemporal dementia
  Mitochondrial disease
  Neoplasm
  Non-small-cell lung cancer
  Parkinsonian disorder
  Precancerous condition
  Prostate cancer
  Prostate carcinoma
  Helicoid peripapillary chorioretinal degeneration
  Thyroid gland papillary carcinoma
• UniProt ID: PSG1_HUMAN
• Pfam ID: PF13895 ; PF13927 ; PF07686
• Sequence:
  MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQ
  NLTGYIWYKGQMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSY
  TLHIIKGDDGTRGVTGRFTFTLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLW
  WMNGQSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLP
  KPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSV
  TRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNP
  PAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[1]
Acute graft versus host disease	DIS8KLVM	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Autoimmune disease	DISORMTM	Strong	Biomarker	[2]
Frontotemporal dementia	DISKYHXL	Strong	Biomarker	[3]
Mitochondrial disease	DISKAHA3	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[6]
Parkinsonian disorder	DISHGY45	Strong	Biomarker	[3]
Precancerous condition	DISV06FL	Strong	Biomarker	[2]
Prostate cancer	DISF190Y	Strong	Biomarker	[7]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[7]
Helicoid peripapillary chorioretinal degeneration	DISFSS5N	Limited	Altered Expression	[8]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Altered Expression	[9]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Pregnancy-specific beta-1-glycoprotein 1 (PSG1).	[10]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Pregnancy-specific beta-1-glycoprotein 1 (PSG1).	[11]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Pregnancy-specific beta-1-glycoprotein 1 (PSG1).	[12]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Pregnancy-specific beta-1-glycoprotein 1 (PSG1).	[13]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Pregnancy-specific beta-1-glycoprotein 1 (PSG1).	[14]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pregnancy-specific beta-1-glycoprotein 1 (PSG1).	[15]

References

• [1] Effects of a Ganoderma atrum polysaccharide against pancreatic damage in streptozotocin-induced diabetic mice.Food Funct. 2019 Nov 1;10(11):7227-7238. doi: 10.1039/c9fo01990a. Epub 2019 Oct 16.
• [2] Recombinant Pregnancy-Specific Glycoprotein 1 Has a Protective Role in a Murine Model of Acute Graft-versus-Host Disease.Biol Blood Marrow Transplant. 2019 Feb;25(2):193-203. doi: 10.1016/j.bbmt.2018.09.022. Epub 2018 Sep 22.
• [3] Tau gene mutation in familial progressive subcortical gliosis.Nat Med. 1999 Apr;5(4):454-7. doi: 10.1038/7454.
• [4] Ganoderma atrum polysaccharide improves doxorubicin-induced cardiotoxicity in mice by regulation of apoptotic pathway in mitochondria.Carbohydr Polym. 2018 Dec 15;202:581-590. doi: 10.1016/j.carbpol.2018.08.144. Epub 2018 Sep 3.
• [5] Toll-like receptor 4 mediates the antitumor host response induced by Ganoderma atrum polysaccharide.J Agric Food Chem. 2015 Jan 21;63(2):517-25. doi: 10.1021/jf5041096. Epub 2015 Jan 9.
• [6] Elevated SP-1 transcription factor expression and activity drives basal and hypoxia-induced vascular endothelial growth factor (VEGF) expression in non-small cell lung cancer.J Biol Chem. 2012 Nov 16;287(47):39967-81. doi: 10.1074/jbc.M112.397042. Epub 2012 Sep 18.
• [7] Predictive value of the UICC and AJCC 8th edition tumor-nodes-metastasis (TNM) classification for patients treated with radical prostatectomy.Cancer Epidemiol. 2018 Oct;56:126-132. doi: 10.1016/j.canep.2018.08.007. Epub 2018 Aug 31.
• [8] Evaluation of the protective effects of Ganoderma atrum polysaccharide on acrylamide-induced injury in small intestine tissue of rats.Food Funct. 2019 Sep 1;10(9):5863-5872. doi: 10.1039/c9fo01452g. Epub 2019 Aug 29.
• [9] RNA sequencing identifies crucial genes in papillary thyroid carcinoma (PTC) progression.Exp Mol Pathol. 2016 Feb;100(1):151-9. doi: 10.1016/j.yexmp.2015.12.011. Epub 2015 Dec 18.
• [10] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [11] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [12] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [13] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [14] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [15] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.