Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4SW0HI)

• DOT Name: Cysteine and glycine-rich protein 2 (CSRP2)
• Synonyms: Cysteine-rich protein 2; CRP2; LIM domain only protein 5; LMO-5; Smooth muscle cell LIM protein; SmLIM
• Gene Name: CSRP2
• Related Disease:
  Advanced cancer
  Gastric cancer
  Stomach cancer
  Breast cancer
  Breast carcinoma
• UniProt ID: CSRP2_HUMAN
• Pfam ID: PF00412
• Sequence:
  MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKS
  CYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCS
  RCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGF
  GYGQGAGALVHAQ
• Function: Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.
• Tissue Specificity: Highly expressed in the aorta, but not in heart and skeletal muscle.
• KEGG Pathway: Cytoskeleton in muscle cells (hsa04820)

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[1]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[1]
Breast cancer	DIS7DPX1	Limited	Biomarker	[2]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[2]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[6]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[7]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[9]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[10]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[11]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[12]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[13]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[14]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[15]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[16]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[17]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[18]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[19]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[20]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[21]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[23]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[26]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[27]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[29]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[30]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Cysteine and glycine-rich protein 2 (CSRP2).	[31]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Cysteine and glycine-rich protein 2 (CSRP2).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Cysteine and glycine-rich protein 2 (CSRP2).	[28]

References

• [1] Exosomal miR-27a Derived from Gastric Cancer Cells Regulates the Transformation of Fibroblasts into Cancer-Associated Fibroblasts.Cell Physiol Biochem. 2018;49(3):869-883. doi: 10.1159/000493218. Epub 2018 Sep 5.
• [2] Hypoxia promotes breast cancer cell invasion through HIF-1-mediated up-regulation of the invadopodial actin bundling protein CSRP2.Sci Rep. 2018 Jul 5;8(1):10191. doi: 10.1038/s41598-018-28637-x.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [6] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [7] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [8] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [9] Gene expression profiling of human peri-implantation endometria between natural and stimulated cycles. Fertil Steril. 2008 Dec;90(6):2152-64.
• [10] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [13] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [14] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [15] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [16] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [17] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [18] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [19] Gene expression in human hippocampus from cocaine abusers identifies genes which regulate extracellular matrix remodeling. PLoS One. 2007 Nov 14;2(11):e1187. doi: 10.1371/journal.pone.0001187.
• [20] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [21] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [22] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [23] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [24] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [25] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [28] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [29] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [30] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [31] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.