Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT63V2KK)

• DOT Name: D-aminoacyl-tRNA deacylase 1 (DTD1)
• Synonyms: DTD; EC 3.1.1.96; DNA-unwinding element-binding protein B; DUE-B; Gly-tRNA(Ala) deacylase; Histidyl-tRNA synthase-related
• Gene Name: DTD1
• Related Disease:
  Adenoma
  Anxiety
  Asthma
  Ataxia-telangiectasia
  Colon carcinoma
  Deafness
  Diastrophic dysplasia
  Gastric cancer
  Neoplasm
  Pancreas disorder
  Stomach cancer
  Lung neoplasm
  Non-small-cell lung cancer
• UniProt ID: DTD1_HUMAN
• PDB ID: 2OKV
• EC Number: 3.1.1.96
• Pfam ID: PF02580
• Sequence:
  MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESG
  KHWSKSVMDKQYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPE
  LIKDGKFGAYMQVHIQNDGPVTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSE
  SSKERNTPRKEDRSASSGAEGDVSSEREP
• Function: Possible ATPase involved in DNA replication, may facilitate loading of CDC45 onto pre-replication complexes ; An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality.
• Tissue Specificity: Expressed in many adult and fetal tissues. Highest levels in testis, ovary, spleen and in adult and fetal brain.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenoma	DIS78ZEV	Strong	Altered Expression	[1]
Anxiety	DISIJDBA	Strong	Genetic Variation	[2]
Asthma	DISW9QNS	Strong	Genetic Variation	[3]
Ataxia-telangiectasia	DISP3EVR	Strong	Genetic Variation	[3]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[4]
Deafness	DISKCLH4	Strong	Genetic Variation	[5]
Diastrophic dysplasia	DISNTGP7	Strong	Genetic Variation	[1]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[6]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Pancreas disorder	DISDH7NI	Strong	Biomarker	[7]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[6]
Lung neoplasm	DISVARNB	Limited	Genetic Variation	[8]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[8]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[9]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[10]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[11]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[12]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[14]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[15]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[16]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[17]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[18]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[19]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[20]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[22]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[23]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of D-aminoacyl-tRNA deacylase 1 (DTD1).	[24]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of D-aminoacyl-tRNA deacylase 1 (DTD1).	[21]

References

• [1] The Pendred syndrome gene encodes a chloride-iodide transport protein.Nat Genet. 1999 Apr;21(4):440-3. doi: 10.1038/7783.
• [2] Meta-analysis of genome-wide association studies for neuroticism in 449,484 individuals identifies novel genetic loci and pathways.Nat Genet. 2018 Jul;50(7):920-927. doi: 10.1038/s41588-018-0151-7. Epub 2018 Jun 25.
• [3] Association analysis of DTD1 gene variations with aspirin-intolerance in asthmatics.Int J Mol Med. 2011 Jul;28(1):129-37. doi: 10.3892/ijmm.2011.669. Epub 2011 Apr 6.
• [4] NAD(P)H:quinone oxidoreductase gene expression in human colon carcinoma cells: characterization of a mutation which modulates DT-diaphorase activity and mitomycin sensitivity.Cancer Res. 1992 Feb 15;52(4):797-802.
• [5] GRM7 variants confer susceptibility to age-related hearing impairment.Hum Mol Genet. 2009 Feb 15;18(4):785-96. doi: 10.1093/hmg/ddn402. Epub 2008 Dec 1.
• [6] Mitomycin C resistance induced by TCF-3 overexpression in gastric cancer cell line MKN28 is associated with DT-diaphorase down-regulation.Cancer Res. 2000 Nov 1;60(21):5959-62.
• [7] The hollow adrenal gland sign: a newly described enhancing pattern of the adrenal gland on dual-phase contrast-enhanced CT for predicting the prognosis of patients with septic shock.Eur Radiol. 2019 Oct;29(10):5378-5385. doi: 10.1007/s00330-019-06172-1. Epub 2019 Apr 1.
• [8] Elevated DT-diaphorase activity and messenger RNA content in human non-small cell lung carcinoma: relationship to the response of lung tumor xenografts to mitomycin C.Cancer Res. 1992 Sep 1;52(17):4752-7.
• [9] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [10] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [11] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [12] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [13] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [14] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [15] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [16] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [17] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [18] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [19] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [20] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [21] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [22] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [23] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [24] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.