Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7FBG5W)

• DOT Name: GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 (ART1)
• Synonyms: EC 2.4.2.31; ADP-ribosyltransferase C2 and C3 toxin-like 1; ARTC1; Mono(ADP-ribosyl)transferase 1; CD antigen CD296
• Gene Name: ART1
• Related Disease:
  Adult glioblastoma
  Advanced cancer
  Arthritis
  Colorectal carcinoma
  Glioblastoma multiforme
  Glomerulonephritis
  Hepatocellular carcinoma
  Immunodeficiency
  Pancreatic cancer
  Squamous cell carcinoma
  Tuberculosis
  High blood pressure
  Neoplasm
  Colon carcinoma
  Nasopharyngeal carcinoma
• UniProt ID: NAR1_HUMAN
• EC Number: 2.4.2.31
• Pfam ID: PF01129
• Sequence:
  MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAA
  LPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLA
  YTANSPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRG
  VHGLRFRPAGPRATVRLGGFASASLKHVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEE
  VLIPPFETFQVINASRLAQGPARIYLRALGKHSTYNCEYIKDKKCKSGPCHLDNSAMGQS
  PLSAVWSLLLLLWFLVVRAFPDGPGLL
• Function: Has ADP-ribosyltransferase activity toward GLP1R.
• Reactome Pathway: Alpha-defensins (R-HSA-1462054)

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[2]
Arthritis	DIST1YEL	Strong	Biomarker	[3]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[4]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[1]
Glomerulonephritis	DISPZIQ3	Strong	Altered Expression	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[6]
Immunodeficiency	DIS093I0	Strong	Biomarker	[7]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[8]
Squamous cell carcinoma	DISQVIFL	Strong	Genetic Variation	[9]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[10]
High blood pressure	DISY2OHH	moderate	Biomarker	[11]
Neoplasm	DISZKGEW	moderate	Biomarker	[2]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[12]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[13]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Uracil mustard	DMHL7OB	Approved	GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 (ART1) increases the Metabolism and nutrition disorders ADR of Uracil mustard.	[17]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 (ART1).	[14]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 (ART1).	[15]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 (ART1).	[16]

References

• [1] Expression of ADP-ribosyltransferase 1 Is Associated with Poor Prognosis of Glioma Patients.Tohoku J Exp Med. 2016 Aug;239(4):269-78. doi: 10.1620/tjem.239.269.
• [2] Effects of -caryophyllene on arginine ADP-ribosyltransferase 1-mediated regulation of glycolysis in colorectal cancer under high-glucose conditions.Int J Oncol. 2018 Oct;53(4):1613-1624. doi: 10.3892/ijo.2018.4506. Epub 2018 Jul 27.
• [3] Peptide-targeted liposomal delivery of dexamethasone for arthritis therapy.Nanomedicine (Lond). 2019 Jun;14(11):1455-1469. doi: 10.2217/nnm-2018-0501. Epub 2019 Apr 2.
• [4] Arginine ADP-ribosyltransferase 1 promotes angiogenesis in colorectal cancer via the PI3K/Akt pathway.Int J Mol Med. 2016 Mar;37(3):734-42. doi: 10.3892/ijmm.2016.2473. Epub 2016 Jan 29.
• [5] CD38 promotes pristane-induced chronic inflammation and increases susceptibility to experimental lupus by an apoptosis-driven and TRPM2-dependent mechanism.Sci Rep. 2018 Feb 20;8(1):3357. doi: 10.1038/s41598-018-21337-6.
• [6] The effects of MIBG on the invasive properties of HepG2 hepatocellular carcinoma cells.Int J Mol Med. 2014 Sep;34(3):842-8. doi: 10.3892/ijmm.2014.1819. Epub 2014 Jun 24.
• [7] Does antiretroviral treatment increase the infectiousness of smear-positive pulmonary tuberculosis?.Int J Tuberc Lung Dis. 2017 Nov 1;21(11):1147-1154. doi: 10.5588/ijtld.17.0162.
• [8] Alu-polymerase chain reaction genomic fingerprinting technique identifies multiple genetic loci associated with pancreatic tumourigenesis.Genes Chromosomes Cancer. 1997 Jan;18(1):30-41. doi: 10.1002/(sici)1098-2264(199701)18:1<30::aid-gcc4>3.0.co;2-2.
• [9] Genetic polymorphisms in DNA base-excision repair genes ADPRT, XRCC1, and APE1 and the risk of squamous cell carcinoma of the head and neck.Cancer. 2007 Aug 15;110(4):867-75. doi: 10.1002/cncr.22861.
• [10] Algorithm-guided empirical tuberculosis treatment for people with advanced HIV (TB Fast Track): an open-label, cluster-randomised trial.Lancet HIV. 2020 Jan;7(1):e27-e37. doi: 10.1016/S2352-3018(19)30266-8. Epub 2019 Nov 11.
• [11] Effect of Angiotensin II Receptor Type 1 Antibodies on Kidney Allograft Function.Iran J Kidney Dis. 2018 Mar;12(2):120-122.
• [12] Effect of ART1 on the proliferation and migration of mouse colon carcinoma CT26 cells invivo.Mol Med Rep. 2017 Mar;15(3):1222-1228. doi: 10.3892/mmr.2017.6152. Epub 2017 Jan 26.
• [13] Discrepant lesion size estimated on T1- and fat-suppressed T2-weighted MRI: diagnostic value for differentiation between inflammatory pseudotumor and carcinoma of the nasopharynx.Diagn Interv Radiol. 2017 May-Jun;23(3):199-205. doi: 10.5152/dir.2017.16241.
• [14] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [15] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [16] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [17] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.