Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7JH0DY)

• DOT Name: Olfactory marker protein (OMP)
• Synonyms: Olfactory neuronal-specific protein
• Gene Name: OMP
• Related Disease:
  Parkinson disease
  Usher syndrome type 1
  Advanced cancer
  Allergic rhinitis
  Alzheimer disease
  Chronic obstructive pulmonary disease
  Craniosynostosis
  Gastric cancer
  Mantle cell lymphoma
  Neoplasm
  Nervous system inflammation
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Usher syndrome
  Meningitis
• UniProt ID: OMP_HUMAN
• Pfam ID: PF06554
• Sequence:
  MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQ
  QRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEA
  DALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
• Function: May act as a modulator of the olfactory signal-transduction cascade.
• Tissue Specificity: Uniquely associated with mature olfactory receptor neurons.

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Parkinson disease	DISQVHKL	Definitive	Biomarker	[1]
Usher syndrome type 1	DISR29E4	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Allergic rhinitis	DIS3U9HN	Strong	Altered Expression	[4]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[5]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Altered Expression	[6]
Craniosynostosis	DIS6J405	Strong	Biomarker	[7]
Gastric cancer	DISXGOUK	Strong	Genetic Variation	[8]
Mantle cell lymphoma	DISFREOV	Strong	Altered Expression	[9]
Neoplasm	DISZKGEW	Strong	Biomarker	[10]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[11]
Prostate cancer	DISF190Y	Strong	Biomarker	[10]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[10]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[8]
Usher syndrome	DIS9YIS7	Strong	Biomarker	[12]
Meningitis	DISQABAA	Limited	Genetic Variation	[13]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Olfactory marker protein (OMP).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Olfactory marker protein (OMP).	[19]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Olfactory marker protein (OMP).	[15]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Olfactory marker protein (OMP).	[16]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Olfactory marker protein (OMP).	[17]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Olfactory marker protein (OMP).	[18]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Olfactory marker protein (OMP).	[20]

References

• [1] Drug-induced Parkinson's disease modulates protein kinase A and Olfactory Marker Protein in the mouse olfactory bulb.Behav Brain Funct. 2017 Jan 26;13(1):1. doi: 10.1186/s12993-017-0119-2.
• [2] Human olfactory marker protein maps close to tyrosinase and is a candidate gene for Usher syndrome type I.Hum Mol Genet. 1993 Feb;2(2):115-8. doi: 10.1093/hmg/2.2.115.
• [3] VDAC electronics: 4. Novel electrical mechanism and thermodynamic estimations of glucose repression of yeast respiration.Biochim Biophys Acta Biomembr. 2017 Nov;1859(11):2213-2223. doi: 10.1016/j.bbamem.2017.09.001. Epub 2017 Sep 6.
• [4] Reversal of Olfactory Disturbance in Allergic Rhinitis Related to OMP Suppression by Intranasal Budesonide Treatment.Allergy Asthma Immunol Res. 2020 Jan;12(1):110-124. doi: 10.4168/aair.2020.12.1.110.
• [5] Amyloid- deposition and olfactory dysfunction in an Alzheimer's disease model.J Alzheimers Dis. 2013;37(4):699-712. doi: 10.3233/JAD-122443.
• [6] Analysis of antigenic structure and human immune response to outer membrane protein CD of Moraxella catarrhalis.Infect Immun. 1999 Sep;67(9):4578-85. doi: 10.1128/IAI.67.9.4578-4585.1999.
• [7] Improving patient care via development of a protein-based diagnostic test for microbe-specific detection of chronic rhinosinusitis.Laryngoscope. 2014 Mar;124(3):608-15. doi: 10.1002/lary.24333. Epub 2013 Oct 2.
• [8] Frizzled-7 Is Required for Wnt Signaling in Gastric Tumors with and Without Apc Mutations.Cancer Res. 2019 Mar 1;79(5):970-981. doi: 10.1158/0008-5472.CAN-18-2095. Epub 2019 Jan 8.
• [9] Notch1 signaling in NOTCH1-mutated mantle cell lymphoma depends on Delta-Like ligand 4 and is a potential target for specific antibody therapy.J Exp Clin Cancer Res. 2019 Nov 1;38(1):446. doi: 10.1186/s13046-019-1458-7.
• [10] Targeted Notch1 inhibition with a Notch1 antibody, OMP-A2G1, decreases tumor growth in two murine models of prostate cancer in association with differing patterns of DNA damage response gene expression.J Cell Biochem. 2019 Oct;120(10):16946-16955. doi: 10.1002/jcb.28954. Epub 2019 May 17.
• [11] Gene Expression Profile of Olfactory Transduction Signaling in an Animal Model of Human Multiple Sclerosis.Exp Neurobiol. 2019 Feb;28(1):74-84. doi: 10.5607/en.2019.28.1.74. Epub 2019 Feb 28.
• [12] Genetic mapping of the gene for Usher syndrome: linkage analysis in a large Samaritan kindred.Genomics. 1994 Mar 1;20(1):36-42. doi: 10.1006/geno.1994.1124.
• [13] Clonal analysis of Haemophilus influenzae type b isolates in the United Kingdom.J Med Microbiol. 1995 Jul;43(1):45-9. doi: 10.1099/00222615-43-1-45.
• [14] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [15] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [16] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [17] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [18] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [19] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [20] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.