General Information of Drug Off-Target (DOT) (ID: OTAYGHDM)

DOT Name Probable E3 ubiquitin-protein ligase MARCHF10 (MARCHF10)
Synonyms EC 2.3.2.27; Membrane-associated RING finger protein 10; Membrane-associated RING-CH protein X; MARCH-X; RING finger protein 190; RING-type E3 ubiquitin transferase MARCHF10
Gene Name MARCHF10
Related Disease
Type-1/2 diabetes ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Classic Hodgkin lymphoma ( )
Myocardial infarction ( )
Obesity ( )
Respiratory failure ( )
Schizophrenia ( )
Stroke ( )
Urinary tract infection ( )
Nervous system disease ( )
Tuberous sclerosis ( )
UniProt ID
MARHA_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.2.27
Pfam ID
PF12906
Sequence
MLHDARDRQKFFSDVQYLRDMQHKVDSEYQACLRRQEYRRDPNEKKRDQFWGQETSFERS
RFSSRSSSKQSSSEEDALTEPRSSIKISAFKCDSKLPAIDQTSVKQKHKSTMTVRKAEKV
DPSEPSPADQAPMVLLRKRKPNLRRFTVSPESHSPRASGDRSRQKQQWPAKVPVPRGADQ
VVQQEGLMCNTKLKRPNQERRNLVPSSQPMTENAPDRAKKGDPSAPSQSELHPALSQAFQ
GKNSPQVLSEFSGPPLTPTTVGGPRKASFRFRDEDFYSILSLNSRRESDDTEEETQSEEC
LWVGVRSPCSPSHHKRSRFGGTSTPQAKNKNFEENAENCRGHSSRRSEPSHGSLRISNAM
EPATERPSAGQRLSQDPGLPDRESATEKDRGGSENAKKSPLSWDTKSEPRQEVGVNAENV
WSDCISVEHRPGTHDSEGYWKDYLNSSQNSLDYFISGRPISPRSSVNSSYNPPASFMHSA
LRDDIPVDLSMSSTSVHSSDSEGNSGFHVCQPLSPIRNRTPFASAENHNYFPVNSAHEFA
VREAEDTTLTSQPQGAPLYTDLLLNPQGNLSLVDSSSSSPSRMNSEGHLHVSGSLQENTP
FTFFAVSHFPNQNDNGSRMAASGFTDEKETSKIKADPEKLKKLQESLLEEDSEEEGDLCR
ICQIAGGSPSNPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLGAVKTCEMCKQGLLV
DLGDFNMIEFYQKHQQSQAQNELMNSGLYLVLLLHLYEQRFAELMRLNHNQVERERLSRN
YPQPRTEENENSELGDGNEGSISQSQVV
Function
E3 ubiquitin-protein ligase (Probable). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Type-1/2 diabetes DISIUHAP Definitive Biomarker [1]
Arteriosclerosis DISK5QGC Strong Genetic Variation [2]
Atherosclerosis DISMN9J3 Strong Genetic Variation [2]
Classic Hodgkin lymphoma DISV1LU6 Strong Genetic Variation [3]
Myocardial infarction DIS655KI Strong Genetic Variation [4]
Obesity DIS47Y1K Strong Biomarker [5]
Respiratory failure DISVMYJO Strong Biomarker [6]
Schizophrenia DISSRV2N Strong Altered Expression [7]
Stroke DISX6UHX Strong Biomarker [8]
Urinary tract infection DISMT6UV Strong Biomarker [9]
Nervous system disease DISJ7GGT moderate Biomarker [10]
Tuberous sclerosis DISEMUGZ moderate Biomarker [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Probable E3 ubiquitin-protein ligase MARCHF10 (MARCHF10). [11]
------------------------------------------------------------------------------------

References

1 Body surface area and glucose tolerance - The smaller the person, the greater the 2-hour plasma glucose.Diabetes Res Clin Pract. 2019 Nov;157:107877. doi: 10.1016/j.diabres.2019.107877. Epub 2019 Oct 14.
2 Nonvalidation of reported genetic risk factors for acute coronary syndrome in a large-scale replication study.JAMA. 2007 Apr 11;297(14):1551-61. doi: 10.1001/jama.297.14.1551.
3 Intensive treatment strategies in advanced-stage Hodgkin's lymphoma (HD9 and HD12): analysis of long-term survival in two randomised trials.Lancet Haematol. 2018 Oct;5(10):e462-e473. doi: 10.1016/S2352-3026(18)30140-6.
4 Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.Atherosclerosis. 2011 Mar;215(1):145-52. doi: 10.1016/j.atherosclerosis.2010.12.005. Epub 2010 Dec 15.
5 Science-based solutions to obesity: what are the roles of academia, government, industry, and health care?.Am J Clin Nutr. 2005 Jul;82(1 Suppl):207S-210S. doi: 10.1093/ajcn/82.1.207S.
6 Effect of Ganciclovir on IL-6 Levels Among Cytomegalovirus-Seropositive Adults With Critical Illness: A Randomized Clinical Trial.JAMA. 2017 Aug 22;318(8):731-740. doi: 10.1001/jama.2017.10569.
7 Psychological interventions for post-traumatic stress disorder (PTSD) in people with severe mental illness.Cochrane Database Syst Rev. 2017 Jan 24;1(1):CD011464. doi: 10.1002/14651858.CD011464.pub2.
8 Burden, clinical outcomes and predictors of time to in hospital mortality among adult patients admitted to stroke unit of Jimma university medical center: a prospective cohort study.BMC Neurol. 2019 Aug 30;19(1):213. doi: 10.1186/s12883-019-1439-7.
9 Prevalence and predictive factors of urinary tract infection among patients with stroke: A meta-analysis.Am J Infect Control. 2018 Apr;46(4):402-409. doi: 10.1016/j.ajic.2017.10.001. Epub 2017 Nov 16.
10 Advances and Future Directions for Tuberous Sclerosis Complex Research: Recommendations From the 2015 Strategic Planning Conference.Pediatr Neurol. 2016 Jul;60:1-12. doi: 10.1016/j.pediatrneurol.2016.03.015. Epub 2016 Apr 2.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.