General Information of Drug Off-Target (DOT) (ID: OTBX300Z)

DOT Name Nuclear receptor coactivator 3 (NCOA3)
Synonyms
NCoA-3; EC 2.3.1.48; ACTR; Amplified in breast cancer 1 protein; AIB-1; CBP-interacting protein; pCIP; Class E basic helix-loop-helix protein 42; bHLHe42; Receptor-associated coactivator 3; RAC-3; Steroid receptor coactivator protein 3; SRC-3; Thyroid hormone receptor activator molecule 1; TRAM-1
Gene Name NCOA3
UniProt ID
NCOA3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1KBH; 3L3X; 3L3Z; 6ES7; 6SQC
EC Number
2.3.1.48
Pfam ID
PF07469 ; PF16279 ; PF16665 ; PF08815 ; PF00989 ; PF14598 ; PF08832
Sequence
MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDID
NFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGE
DLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
HGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLA
DPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNI
MISPRNRGSPKIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLST
LSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
SSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVS
SSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGN
VVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQE
KDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLK
SSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
SMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPT
LPLRSNSIPGARPVLQQQQQMLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQV
SHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPE
LVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSMMN
QMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENPTA
GGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQ
PDPAFGRVSSPPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQ
FAHQGNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC
Function
Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Plays a central role in creating a multisubunit coactivator complex, which probably acts via remodeling of chromatin. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ER), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Displays histone acetyltransferase activity. Also involved in the coactivation of the NF-kappa-B pathway via its interaction with the NFKB1 subunit.
Tissue Specificity Widely expressed. High expression in heart, skeletal muscle, pancreas and placenta. Low expression in brain, and very low in lung, liver and kidney.
KEGG Pathway
Endocrine resistance (hsa01522 )
Estrogen sig.ling pathway (hsa04915 )
Thyroid hormone sig.ling pathway (hsa04919 )
Pathways in cancer (hsa05200 )
Breast cancer (hsa05224 )
Reactome Pathway
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )
MAPK6/MAPK4 signaling (R-HSA-5687128 )
Estrogen-dependent gene expression (R-HSA-9018519 )
PPARA activates gene expression (R-HSA-1989781 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Calcitriol DM8ZVJ7 Approved Nuclear receptor coactivator 3 (NCOA3) increases the response to substance of Calcitriol. [24]
------------------------------------------------------------------------------------
27 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Nuclear receptor coactivator 3 (NCOA3). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Nuclear receptor coactivator 3 (NCOA3). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [5]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [6]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Nuclear receptor coactivator 3 (NCOA3). [7]
Marinol DM70IK5 Approved Marinol increases the expression of Nuclear receptor coactivator 3 (NCOA3). [8]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of Nuclear receptor coactivator 3 (NCOA3). [9]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Nuclear receptor coactivator 3 (NCOA3). [10]
Testosterone enanthate DMB6871 Approved Testosterone enanthate increases the expression of Nuclear receptor coactivator 3 (NCOA3). [11]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Nuclear receptor coactivator 3 (NCOA3). [7]
Estrone DM5T6US Approved Estrone increases the expression of Nuclear receptor coactivator 3 (NCOA3). [12]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Nuclear receptor coactivator 3 (NCOA3). [13]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [14]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [2]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Nuclear receptor coactivator 3 (NCOA3). [15]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Nuclear receptor coactivator 3 (NCOA3). [16]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Nuclear receptor coactivator 3 (NCOA3). [17]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Nuclear receptor coactivator 3 (NCOA3). [19]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [5]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [1]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [20]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [21]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Nuclear receptor coactivator 3 (NCOA3). [22]
4-ANDROSTENE-3-17-DIONE DMSE8NU Investigative 4-ANDROSTENE-3-17-DIONE increases the activity of Nuclear receptor coactivator 3 (NCOA3). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 27 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Nuclear receptor coactivator 3 (NCOA3). [18]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Nuclear receptor coactivator 3 (NCOA3). [18]
------------------------------------------------------------------------------------

References

1 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
6 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
8 Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
9 Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
10 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
11 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
12 LC, a novel estrone-rhein hybrid compound, promotes proliferation and differentiation and protects against cell death in human osteoblastic MG-63 cells. Mol Cell Endocrinol. 2011 Sep 15;344(1-2):59-68. doi: 10.1016/j.mce.2011.06.027. Epub 2011 Jul 13.
13 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
14 Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
15 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
16 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
17 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
18 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
19 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
20 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
21 Involvement of SRC-3 in deguelin-induced apoptosis in Jurkat cells. Int J Hematol. 2009 Jun;89(5):628-35. doi: 10.1007/s12185-009-0311-8. Epub 2009 Apr 14.
22 Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.
23 ErbB receptor signaling and therapeutic resistance to aromatase inhibitors. Clin Cancer Res. 2006 Feb 1;12(3 Pt 2):1008s-1012s. doi: 10.1158/1078-0432.CCR-05-2352.
24 Functional diversification of vitamin D receptor paralogs in teleost fish after a whole genome duplication event. Endocrinology. 2014 Dec;155(12):4641-54. doi: 10.1210/en.2014-1505. Epub 2014 Oct 3.