Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCOEZRV)

• DOT Name: Cell division cycle protein 20 homolog (CDC20)
• Synonyms: p55CDC
• Gene Name: CDC20
• Related Disease: Oocyte maturation defect 14
• UniProt ID: CDC20_HUMAN
• PDB ID: 4GGA; 4GGC; 4GGD; 4N14; 5G04; 5KHR; 5KHU; 5LCW; 6F0X; 6Q6G; 6Q6H
• Pfam ID: PF12894 ; PF00400
• Sequence:
  MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
  GKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNL
  NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
  IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
  LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH
  HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
  VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
  AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
  REREKASAAKSSLIHQGIR
• Function: Involved in the metaphase/anaphase transition of cell cycle. Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation. The CDC20-APC/C complex promotes proper dilation formation and radial migration by degrading CCDC41.
• KEGG Pathway:
  Cell cycle (hsa04110)
  Oocyte meiosis (hsa04114)
  Ubiquitin mediated proteolysis (hsa04120)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Viral carcinogenesis (hsa05203)
• Reactome Pathway:
  Inactivation of APC/C via direct inhibition of the APC/C complex (R-HSA-141430)
  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal (R-HSA-141444)
  APC/C (R-HSA-174048)
  SCF-beta-TrCP mediated degradation of Emi1 (R-HSA-174113)
  APC/C (R-HSA-174154)
  APC/C (R-HSA-174178)
  Cdc20 (R-HSA-174184)
  Conversion from APC/C (R-HSA-176407)
  Regulation of APC/C activators between G1/S and early anaphase (R-HSA-176408)
  APC/C (R-HSA-176409)
  Phosphorylation of Emi1 (R-HSA-176417)
  APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)
  Separation of Sister Chromatids (R-HSA-2467813)
  Resolution of Sister Chromatid Cohesion (R-HSA-2500257)
  RHO GTPases Activate Formins (R-HSA-5663220)
  Ub-specific processing proteases (R-HSA-5689880)
  Mitotic Prometaphase (R-HSA-68877)
  EML4 and NUDC in mitotic spindle formation (R-HSA-9648025)
  Antigen processing (R-HSA-983168)
  Inhibition of the proteolytic activity of APC/C required for the onset of anaphase by mitotic spindle checkpoint components (R-HSA-141405)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Oocyte maturation defect 14	DIS35IEF	Strong	Autosomal recessive	[1]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Irinotecan	DMP6SC2	Approved	Cell division cycle protein 20 homolog (CDC20) increases the response to substance of Irinotecan.	[46]

46 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Cell division cycle protein 20 homolog (CDC20).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[12]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[12]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[14]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[15]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Cell division cycle protein 20 homolog (CDC20).	[16]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[17]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[18]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[19]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Cell division cycle protein 20 homolog (CDC20).	[20]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[21]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[22]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[23]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[24]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[25]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[26]
Atropine	DMEN6X7	Approved	Atropine increases the expression of Cell division cycle protein 20 homolog (CDC20).	[27]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[28]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Cell division cycle protein 20 homolog (CDC20).	[29]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[30]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Cell division cycle protein 20 homolog (CDC20).	[31]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[33]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[34]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[35]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Cell division cycle protein 20 homolog (CDC20).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[39]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[40]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[41]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Cell division cycle protein 20 homolog (CDC20).	[42]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[43]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[44]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[11]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[21]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate decreases the expression of Cell division cycle protein 20 homolog (CDC20).	[45]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Cell division cycle protein 20 homolog (CDC20).	[36]

References

• [1] Cdc20 is critical for meiosis I and fertility of female mice. PLoS Genet. 2010 Sep 30;6(9):e1001147. doi: 10.1371/journal.pgen.1001147.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [8] Transcriptomics analysis and benchmark concentration estimating-based in vitro test with IOSE80 cells to unveil the mode of action for female reproductive toxicity of bisphenol A at human-relevant levels. Ecotoxicol Environ Saf. 2022 Jun 1;237:113523. doi: 10.1016/j.ecoenv.2022.113523. Epub 2022 Apr 13.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] [Effects of Arsenic Trioxide on Cdc20 and Mad2 in Acute Myeloid Leukemia HL-60 Cell Line]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2018 Jun;26(3):710-715. doi: 10.7534/j.issn.1009-2137.2018.03.013.
• [11] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [12] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [13] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [14] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [15] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [16] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [17] mTOR inhibition reverses acquired endocrine therapy resistance of breast cancer cells at the cell proliferation and gene-expression levels. Cancer Sci. 2008 Oct;99(10):1992-2003. doi: 10.1111/j.1349-7006.2008.00955.x.
• [18] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [19] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [20] Analysis of gene expression induced by diethylstilbestrol (DES) in human primitive Mullerian duct cells using microarray. Cancer Lett. 2005 Apr 8;220(2):197-210.
• [21] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [22] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [23] Application of oligonucleotide microarray technology to toxic occupational exposures. J Toxicol Environ Health A. 2008;71(5):315-24.
• [24] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [25] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [26] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [27] Gene expression signature of parathion-transformed human breast epithelial cells. Int J Mol Med. 2007 May;19(5):741-50.
• [28] Targeting pioneering factor and hormone receptor cooperative pathways to suppress tumor progression. Cancer Res. 2012 Mar 1;72(5):1248-59. doi: 10.1158/0008-5472.CAN-11-0943. Epub 2012 Jan 18.
• [29] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [30] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [31] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [32] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [33] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [34] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [35] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [36] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [37] The genome-wide expression profile of Scrophularia ningpoensis-treated thapsigargin-stimulated U-87MG cells. Neurotoxicology. 2009 May;30(3):368-76.
• [38] Bisphenol-A exposure and gene expression in human luteinized membrana granulosa cells in vitro. Hum Reprod. 2017 Feb;32(2):409-417. doi: 10.1093/humrep/dew316. Epub 2016 Dec 15.
• [39] MCM-2 is a therapeutic target of Trichostatin A in colon cancer cells. Toxicol Lett. 2013 Jul 31;221(1):23-30. doi: 10.1016/j.toxlet.2013.05.643. Epub 2013 Jun 13.
• [40] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [41] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [42] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [43] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [44] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [45] In Vitro Exposure of Human Luteinized Mural Granulosa Cells to Dibutyl Phthalate Affects Global Gene Expression. Toxicol Sci. 2017 Nov 1;160(1):180-188. doi: 10.1093/toxsci/kfx170.
• [46] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.