Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTD1P6LA)

• DOT Name: F-box only protein 30 (FBXO30)
• Gene Name: FBXO30
• UniProt ID: FBX30_HUMAN
• PDB ID: 2YRE
• Pfam ID: PF15966 ; PF15965
• Sequence:
  MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPC
  LNSDFGCPFTMARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRKSYENLSRDVDEVAQL
  DMALALQDQRMLLESLKVATMMSKATDKVSKPREQISVKSSVPEIPHANGLVSVDEESYG
  ALYQATVETTRSLAAALDILNTATRDIGMLNTSVPNDMDEQQNARESLEDQNLKDQDHLY
  EEEIGAVGGIDYNDTNQNAQSEQNGSSDLLCDLNTSSYDTSALCNGFPLENICTQVIDQN
  QNLHGDSKQSNLTNGDCVASSDGTSKPSSSLAVAAQLREIIPSSALPNGTVQHILMPDDE
  GEGELCWKKVDLGDVKNVDVLSFSHAPSFNFLSNSCWSKPKEDKAVDTSDLEVAEDPMGL
  QGIDLITAALLFCLGDSPGGRGISDSRMADIYHIDVGTQTFSLPSAILATSTMVGEIASA
  SACDHANPQLSNPSPFQTLGLDLVLECVARYQPKQRSMFTFVCGQLFRRKEFSSHFKNVH
  GDIHAGLNGWMEQRCPLAYYGCTYSQRRFCPSIQGAKIIHDRHLRSFGVQPCVSTVLVEP
  ARNCVLGLHNDHLSSLPFEVLQHIAGFLDGFSLCQLSCVSKLMRDVCGSLLQSRGMVILQ
  WGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNVVEKREEAIP
  LPCMCVTRELTKEGRSLRSVLKPVL
• Function: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Required for muscle atrophy following denervation.
• Reactome Pathway:
  Antigen processing (R-HSA-983168)
  Neddylation (R-HSA-8951664)

Molecular Interaction Atlas (MIA) of This DOT

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of F-box only protein 30 (FBXO30).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of F-box only protein 30 (FBXO30).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen affects the expression of F-box only protein 30 (FBXO30).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of F-box only protein 30 (FBXO30).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of F-box only protein 30 (FBXO30).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of F-box only protein 30 (FBXO30).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of F-box only protein 30 (FBXO30).	[7]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of F-box only protein 30 (FBXO30).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of F-box only protein 30 (FBXO30).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of F-box only protein 30 (FBXO30).	[10]
Marinol	DM70IK5	Approved	Marinol increases the expression of F-box only protein 30 (FBXO30).	[11]
Menadione	DMSJDTY	Approved	Menadione increases the expression of F-box only protein 30 (FBXO30).	[12]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of F-box only protein 30 (FBXO30).	[13]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of F-box only protein 30 (FBXO30).	[13]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of F-box only protein 30 (FBXO30).	[6]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of F-box only protein 30 (FBXO30).	[6]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of F-box only protein 30 (FBXO30).	[6]
Chlorambucil	DMRKE63	Approved	Chlorambucil decreases the expression of F-box only protein 30 (FBXO30).	[13]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of F-box only protein 30 (FBXO30).	[14]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of F-box only protein 30 (FBXO30).	[16]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of F-box only protein 30 (FBXO30).	[17]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of F-box only protein 30 (FBXO30).	[13]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of F-box only protein 30 (FBXO30).	[18]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of F-box only protein 30 (FBXO30).	[15]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
• [10] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [11] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [12] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [13] Oxidative stress mechanisms do not discriminate between genotoxic and nongenotoxic liver carcinogens. Chem Res Toxicol. 2015 Aug 17;28(8):1636-46.
• [14] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [15] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [16] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [17] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [18] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.