Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDC7UHL)

• DOT Name: Myeloma-overexpressed gene protein (MYEOV)
• Synonyms: Oncogene in multiple myeloma
• Gene Name: MYEOV
• Related Disease:
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiovascular disease
  Esophageal squamous cell carcinoma
  Non-small-cell lung cancer
  Small lymphocytic lymphoma
  Squamous cell carcinoma
  Stomach cancer
  Adenocarcinoma
  Gastric adenocarcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Lung cancer
  Lung carcinoma
  Neoplasm
  Neuroblastoma
  Plasma cell myeloma
• UniProt ID: MYEOV_HUMAN
• Sequence:
  MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMF
  TRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAG
  LSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARVVGVAHLGEAFRVGVEQAISSC
  PEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCMTLAESSCPDYERGRRACLTLH
  RHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLH
  HLLLLLLIIILTC

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[2]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[3]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[4]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[5]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[6]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[4]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[7]
Adenocarcinoma	DIS3IHTY	moderate	Biomarker	[8]
Gastric adenocarcinoma	DISWWLTC	moderate	Biomarker	[8]
Colon cancer	DISVC52G	Limited	Biomarker	[9]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[9]
Lung cancer	DISCM4YA	Limited	Altered Expression	[10]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[10]
Neoplasm	DISZKGEW	Limited	Altered Expression	[8]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[11]
Plasma cell myeloma	DIS0DFZ0	Limited	Genetic Variation	[12]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Myeloma-overexpressed gene protein (MYEOV).	[13]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Myeloma-overexpressed gene protein (MYEOV).	[14]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Myeloma-overexpressed gene protein (MYEOV).	[15]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Myeloma-overexpressed gene protein (MYEOV).	[16]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Myeloma-overexpressed gene protein (MYEOV).	[17]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Myeloma-overexpressed gene protein (MYEOV).	[18]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Myeloma-overexpressed gene protein (MYEOV).	[19]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Myeloma-overexpressed gene protein (MYEOV).	[20]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Myeloma-overexpressed gene protein (MYEOV).	[21]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Myeloma-overexpressed gene protein (MYEOV).	[23]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Myeloma-overexpressed gene protein (MYEOV).	[24]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Myeloma-overexpressed gene protein (MYEOV).	[25]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Myeloma-overexpressed gene protein (MYEOV).	[22]

References

• [1] Different mechanisms of cyclin D1 overexpression in multiple myeloma revealed by fluorescence in situ hybridization and quantitative analysis of mRNA levels.Blood. 2004 Aug 15;104(4):1120-6. doi: 10.1182/blood-2003-11-3837. Epub 2004 Apr 13.
• [2] MYEOV: a candidate gene for DNA amplification events occurring centromeric to CCND1 in breast cancer.Int J Cancer. 2002 Dec 20;102(6):608-14. doi: 10.1002/ijc.10765.
• [3] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [4] MYEOV, a gene at 11q13, is coamplified with CCND1, but epigenetically inactivated in a subset of esophageal squamous cell carcinomas.J Hum Genet. 2002;47(9):460-4. doi: 10.1007/s100380200065.
• [5] MYEOV functions as an amplified competing endogenous RNA in promoting metastasis by activating TGF- pathway in NSCLC.Oncogene. 2019 Feb;38(6):896-912. doi: 10.1038/s41388-018-0484-9. Epub 2018 Sep 4.
• [6] Expression of the c-myc proto-oncogene in multiple myeloma and chronic lymphocytic leukemia: an in situ analysis.Blood. 1991 Jul 1;78(1):180-91.
• [7] Rearrangement and expression of myeov and hst in NIH/3T3 transfectants: a caveat for the interpretation of DNA transfection analyses.Oncol Rep. 2007 May;17(5):1127-31.
• [8] Net1 and Myeov: computationally identified mediators of gastric cancer.Br J Cancer. 2006 Apr 24;94(8):1204-12. doi: 10.1038/sj.bjc.6603054.
• [9] MYEOV (myeloma overexpressed gene) drives colon cancer cell migration and is regulated by PGE2.J Exp Clin Cancer Res. 2010 Jun 22;29(1):81. doi: 10.1186/1756-9966-29-81.
• [10] Integrative CAGE and DNA Methylation Profiling Identify Epigenetically Regulated Genes in NSCLC.Mol Cancer Res. 2017 Oct;15(10):1354-1365. doi: 10.1158/1541-7786.MCR-17-0191. Epub 2017 Jul 11.
• [11] Aberrations of NEGR1 on 1p31 and MYEOV on 11q13 in neuroblastoma.Cancer Sci. 2011 Sep;102(9):1645-50. doi: 10.1111/j.1349-7006.2011.01995.x. Epub 2011 Jul 3.
• [12] MYEOV is a prognostic factor in multiple myeloma.Exp Hematol. 2010 Dec;38(12):1189-1198.e3. doi: 10.1016/j.exphem.2010.09.002. Epub 2010 Sep 18.
• [13] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [14] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [15] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [16] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [17] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [18] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [19] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [20] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [21] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [22] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [23] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [24] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [25] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.