Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDUZ296)

• DOT Name: StAR-related lipid transfer protein 7, mitochondrial (STARD7)
• Synonyms: Gestational trophoblastic tumor protein 1; START domain-containing protein 7; StARD7
• Gene Name: STARD7
• Related Disease:
  Abdominal aortic aneurysm
  Choriocarcinoma
  Coronary heart disease
  Epilepsy, familial adult myoclonic, 2
  Gestational trophoblastic neoplasia
  Myocardial infarction
  Neoplasm
  Coronary atherosclerosis
  Acute coronary syndrome
• UniProt ID: STAR7_HUMAN
• Pfam ID: PF01852
• Sequence:
  MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLLGR
  LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHH
  PPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFF
  NVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQEN
  NMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPR
  YCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEG
  SCGPARIEYA
• Function: May play a protective role in mucosal tissues by preventing exaggerated allergic responses.
• Tissue Specificity: Expressed in nasal epithelial cells. Down-regulated in nasal epithelial cells in patients experiencing an asthma exacerbation as compared to stable asthmatics and healthy controls.
• Reactome Pathway: Synthesis of PC (R-HSA-1483191)

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Abdominal aortic aneurysm	DISD06OF	Strong	Biomarker	[1]
Choriocarcinoma	DISDBVNL	Strong	Altered Expression	[2]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[3]
Epilepsy, familial adult myoclonic, 2	DIS44I9V	Strong	Biomarker	[4]
Gestational trophoblastic neoplasia	DIS4EJNA	Strong	Altered Expression	[2]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[5]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Coronary atherosclerosis	DISKNDYU	Disputed	Biomarker	[3]
Acute coronary syndrome	DIS7DYEW	Limited	Biomarker	[4]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	StAR-related lipid transfer protein 7, mitochondrial (STARD7) affects the response to substance of Acetaminophen.	[14]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of StAR-related lipid transfer protein 7, mitochondrial (STARD7).	[6]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of StAR-related lipid transfer protein 7, mitochondrial (STARD7).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of StAR-related lipid transfer protein 7, mitochondrial (STARD7).	[8]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of StAR-related lipid transfer protein 7, mitochondrial (STARD7).	[10]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of StAR-related lipid transfer protein 7, mitochondrial (STARD7).	[11]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of StAR-related lipid transfer protein 7, mitochondrial (STARD7).	[12]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of StAR-related lipid transfer protein 7, mitochondrial (STARD7).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of StAR-related lipid transfer protein 7, mitochondrial (STARD7).	[9]

References

• [1] Randomized Placebo-Controlled Trial Assessing the Effect of 24-Week Fenofibrate Therapy on Circulating Markers of Abdominal Aortic Aneurysm: Outcomes From the FAME -2 Trial.J Am Heart Assoc. 2018 Oct 2;7(19):e009866. doi: 10.1161/JAHA.118.009866.
• [2] GTT1/StarD7, a novel phosphatidylcholine transfer protein-like highly expressed in gestational trophoblastic tumour: cloning and characterization.Placenta. 2004 Jan;25(1):37-44. doi: 10.1016/S0143-4004(03)00214-5.
• [3] Association of Improvement in Fractional Flow Reserve With Outcomes, Including Symptomatic Relief, After Percutaneous Coronary Intervention.JAMA Cardiol. 2019 Apr 1;4(4):370-374. doi: 10.1001/jamacardio.2019.0175.
• [4] Fractional flow reserve-guided percutaneous coronary intervention vs. medical therapy for patients with stable coronary lesions: meta-analysis of individual patient data.Eur Heart J. 2019 Jan 7;40(2):180-186. doi: 10.1093/eurheartj/ehy812.
• [5] High Coronary Shear Stress in Patients With Coronary Artery Disease Predicts Myocardial Infarction.J Am Coll Cardiol. 2018 Oct 16;72(16):1926-1935. doi: 10.1016/j.jacc.2018.07.075.
• [6] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [7] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [10] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [11] Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
• [12] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [13] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [14] Interindividual variation in gene expression responses and metabolite formation in acetaminophen-exposed primary human hepatocytes. Arch Toxicol. 2016 May;90(5):1103-15. doi: 10.1007/s00204-015-1545-2. Epub 2015 Jun 24.